Product name:Amyloid β-Peptide(1-43)(human)
Catalog No.:DC41815
CAS No.:134500-80-4
Identified uses : Laboratory chemicals, manufacture of substances
Company: DC Chemicals
TollFree: +86-21-58447131
Tel: +86-21-58447131
Fax: +86-21-61642470
Emergency phone #: +86-21-58447131
GHS Classification in accordance with 29 CFR 1910 (OSHA HCS)
Acute toxicity, Oral (Category 4), H302
Acute aquatic toxicity (Category 1), H400
Chronic aquatic toxicity (Category 1), H410
No data available
Harmful if swallowed.
Very toxic to aquatic life with long lasting effects.
Wash skin thoroughly after handling.
Do not eat, drink or smoke when using this product.
Avoid release to the environment.
IF SWALLOWED: Call a POISON CENTER or doctor/ physician if you feel unwell.
Rinse mouth.
Collect spillage.
Dispose of contents/ container to an approved waste disposal plant.
None.
Synonyms: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Formula:C207H318N56O62S
Molecular Weight:4615.19
CAS No.: 134500-80-4
Eye contact
Remove any contact lenses, locate eye-wash station, and flush eyes immediately with large amounts of
water. Separate eyelids with fingers to ensure adequate flushing. Promptly call a physician.
Skin contact
Rinse skin thoroughly with large amounts of water. Remove contaminated clothing and shoes and call a physician.
Inhalation
Immediately relocate self or casualty to fresh air. If breathing is difficult, give cardiopulmonary resuscitation
(CPR). Avoid mouth-to-mouth resuscitation.
Ingestion
Wash out mouth with water; Do NOT induce vomiting; call a physician.
The most important known symptoms and effects are described in the labelling (see section 2.2).
Treat symptomatically.
Suitable extinguishing media
Use water spray, dry chemical, foam, and carbon dioxide fire extinguisher.
During combustion, may emit irritant fumes.
Wear self-contained breathing apparatus and protective clothing.
Use full personal protective equipment. Avoid breathing vapors, mist, dust or gas. Ensure adequate ventilation. Evacuate personnel to safe areas.
Refer to protective measures listed in sections 8.
Try to prevent further leakage or spillage. Keep the product away from drains or water courses.
Absorb solutions with finely-powdered liquid-binding material (diatomite, universal binders); Decontaminate surfaces and equipment by scrubbing with alcohol; Dispose of contaminated material according to Section 13.
Avoid inhalation, contact with eyes and skin. Avoid dust and aerosol formation. Use only in areas with appropriate exhaust ventilation.
Keep container tightly sealed in cool, well-ventilated area. Keep away from direct sunlight and sources of
ignition.
Store at -20°C(powder) or -80°C( in solvent)
No data available.
Components with workplace control parameters
This product contains no substances with occupational exposure limit values.
Engineering controls
Ensure adequate ventilation. Provide accessible safety shower and eye wash station.
Personal protective equipment
Eye protection | Safety goggles with side-shields. |
---|---|
Hand protection | Protective gloves. |
Skin and body protection | Impervious clothing. |
Respiratory protection | Suitable respirator. |
Environmental exposure controls | Keep the product away from drains, water courses or the soil. Clean spillages in a safe way as soon as possible. |
Appearance | solid |
---|---|
Odor | No data available |
Odor threshold | No data available |
pH | No data available |
Melting/freezing point | No data available |
Boiling point/range | No data available |
Flash point | No data available |
Evaporation rate | No data available |
Flammability (solid, gas) | No data available |
Upper/lower flammability or explosive limits | No data available |
Vapor pressure | No data available |
Vapor density | No data available |
Relative density | No data available |
Water solubility | No data available |
Partition coefficient | No data available |
Auto-ignition temperature | No data available |
Decomposition temperature | No data available |
Viscosity | No data available |
Explosive properties | No data available |
Oxidizing properties | No data available |
No data available.
No data available.
Stable under recommended storage conditions.
No data available.
No data available.
Strong acids/alkalis, strong oxidising/reducing agents.
Under fire conditions, may decompose and emit toxic fumes.
Other decomposition products - no data available.
Acute toxicity
Classified based on available data. For more details, see section 2.
Skin corrosion/irritation
Classified based on available data. For more details, see section 2.
Serious eye damage/irritation
Classified based on available data. For more details, see section 2.
Respiratory or skin sensitization
Classified based on available data. For more details, see section 2.
Germ cell mutagenicity
Classified based on available data. For more details, see section 2.
Carcinogenicity
IARC: No component of this product present at a level equal to or greater than 0.1% is identified as
probable, possible or confirmed human carcinogen by IARC.
ACGIH: No component of this product present at a level equal to or greater than 0.1% is identified as a
potential or confirmed carcinogen by ACGIH.
NTP: No component of this product present at a level equal to or greater than 0.1% is identified as a
anticipated or confirmed carcinogen by NTP.
OSHA: No component of this product present at a level equal to or greater than 0.1% is identified as a
potential or confirmed carcinogen by OSHA.
Reproductive toxicity
Classified based on available data. For more details, see section 2.
Specific target organ toxicity - single exposure
Classified based on available data. For more details, see section 2.
Specific target organ toxicity - repeated exposure
Classified based on available data. For more details, see section 2.
Aspiration hazard
Classified based on available data. For more details, see section 2.
Additional information
RTECS No.: Unavailable
This information is based on our current knowledge. However the chemical, physical, and toxicological
properties have not been completely investigated.
No data available.
No data available.
No data available.
No data available.
PBT/vPvB assessment unavailable as chemical safety assessment not required or not conducted.
No data available.
Product
Dispose substance in accordance with prevailing country, federal, state and local regulations.
Contaminated packaging
Conduct recycling or disposal in accordance with prevailing country, federal, state and local regulations.
DOT (US)
This substance is considered to be non-hazardous for transport.
IMDG
This substance is considered to be non-hazardous for transport.
IATA
This substance is considered to be non-hazardous for transport.
SARA 302 Components:
No chemicals in this material are subject to the reporting requirements of SARA Title III, Section 302.
SARA 313 Components:
This material does not contain any chemical components with known CAS numbers that exceed the
threshold (De Minimis) reporting levels established by SARA Title III, Section 313.
SARA 311/312 Hazards:
Acute Health Hazard.
Massachusetts Right To Know Components:
No components are subject to the Massachusetts Right to Know Act.
Pennsylvania Right To Know Components:
No components are subject to the Pennsylvania Right to Know Act.
New Jersey Right To Know Components:
No components are subject to the New Jersey Right to Know Act.
California Prop. 65 Components:
This product does not contain any chemicals known to State of California to cause cancer, birth defects, or
any other reproductive harm.
The above information is believed to be correct based on our present knowledge but does not purport to be complete. The product is for research use only and for trained personnel. The burden of safe use of this material rests entirely with the user. DC Chemicals disclaims all liability for any damage resulting from use of this material.