Beta-defensin 103 isoform X1, pig TFA|CAS 0|DC Chemicals

Cas No.:
Chemical Name:	Beta-defensin 103 isoform X1, pig TFA
Synonyms:	MRIHYLLFALLFLFLMPLPGNGRIINTLQRYYCKIRRGRCAVLGCLPKEEQIGSCSVSGRKCCRKRK
Formula:	C₃₄₈H₅₇₆N₁₀₅F₃O₈₅S₈
M.Wt:	7904.56
Sotrage:	Please store the product under the recommended conditions in the Certificate of Analysis.

Cat. No.	Product name	Field of application
DC47747	MDP1 acetate	MDP1 acetate, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 acetate has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa.
DC47746	MDP1	MDP1, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa.
DC47745	NBTIs-IN-4	NBTIs-IN-4 demonstrates potent antibacterial activity against diverse Gram-positive pathogens, inhibition of both DNA gyrase and topoisomerase IV, a low frequency of resistance.
DC47744	Antibacterial agent 62	Antibacterial agent 62 is a novel redox cycling antituberculosis chemotype with potent bactericidal activity against growing and nutrient-starved phenotypically drug-resistant nongrowing bacteria.
DC47743	Anti gram-positive/negative bacteria agent 1	Anti gram-positive/negative bacteria agent 1 is an antibiotic conjugate with an artificial MECAM-based siderophore.
DC47742	Antibacterial agent 63	Antibacterial agent 63, a conjugate of aztreonam to a siderophore mimetic, shows activity against gram-negative bacteria.
DC47741	LpxA-IN-1	LpxA-IN-1 is a novel UDP-N-acetylglucosamine acyltransferase (LpxA) inhibitor (IC50 2 nM) with activity against Pseudomonas aeruginosa (MIC 8 μg/mL).
DC47740	Urease-IN-1	Urease-IN-1 is an urease inhibitor with an IC50 value of 2.21 ± 0.45 µM.
DC47739	JPD447	JPD447, a MAC-0547630 derivative, is a novel class of UppS inhibitor to potentiate β-lactam antibiotics.
DC47738	(8′α,9′β-Dihydroxy)-3-farnesylindole	(8'α,9'β-Dihydroxy)-3-farnesylindole shows strong inhibitory activity (EC50 9.8 μM) against B. subtilis.