Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

Beta-defensin 103 isoform X1, pig TFA

  Cat. No.:  DC41890  
Chemical Structure
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens.
Cas No.:
Chemical Name: Beta-defensin 103 isoform X1, pig TFA
Synonyms: MRIHYLLFALLFLFLMPLPGNGRIINTLQRYYCKIRRGRCAVLGCLPKEEQIGSCSVSGRKCCRKRK
Formula: C348H576N105F3O85S8
M.Wt: 7904.56
Sotrage: Please store the product under the recommended conditions in the Certificate of Analysis.
Cat. No. Product name Field of application
DC47747 MDP1 acetate MDP1 acetate, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 acetate has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa.
DC47746 MDP1 MDP1, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa.
DC47745 NBTIs-IN-4 NBTIs-IN-4 demonstrates potent antibacterial activity against diverse Gram-positive pathogens, inhibition of both DNA gyrase and topoisomerase IV, a low frequency of resistance.
DC47744 Antibacterial agent 62 Antibacterial agent 62 is a novel redox cycling antituberculosis chemotype with potent bactericidal activity against growing and nutrient-starved phenotypically drug-resistant nongrowing bacteria.
DC47743 Anti gram-positive/negative bacteria agent 1 Anti gram-positive/negative bacteria agent 1 is an antibiotic conjugate with an artificial MECAM-based siderophore.
DC47742 Antibacterial agent 63 Antibacterial agent 63, a conjugate of aztreonam to a siderophore mimetic, shows activity against gram-negative bacteria.
DC47741 LpxA-IN-1 LpxA-IN-1 is a novel UDP-N-acetylglucosamine acyltransferase (LpxA) inhibitor (IC50 2 nM) with activity against Pseudomonas aeruginosa (MIC 8 μg/mL).
DC47740 Urease-IN-1 Urease-IN-1 is an urease inhibitor with an IC50 value of 2.21 ± 0.45 µM.
DC47739 JPD447 JPD447, a MAC-0547630 derivative, is a novel class of UppS inhibitor to potentiate β-lactam antibiotics.
DC47738 (8′α,9′β-Dihydroxy)-3-farnesylindole (8'α,9'β-Dihydroxy)-3-farnesylindole shows strong inhibitory activity (EC50 9.8 μM) against B. subtilis.
X