Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.
Home > Inhibitors & Agonists > Metabolic Enzyme/Protease > Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

You can also try the following methods, and our professionals will serve you Customized Consultation
Cat. No. Product Name Field of Application Chemical Structure
DC79485 YM-1 TFA
YM-1 (TFA) is an inhibitor of angiotensin converting enzyme (ACE) that can be obtained from Chrysanthemum boreale Makino.
More description
DC79145 HOE-288
HOE-288 is an orally active angiotensin-converting enzyme (ACE) inhibitor. HOE-288 can be used for the research of neurological disease.
More description
DC76838 Rev 6207 free base
Rev 6207 (free base) is a potent non-thiol angiotensin I converting enzyme inhibitor. Rev 6207 (free base) has comparable antihypertensive activity to Enalapril in awake monkeys with high renin activity and can be used in the study of hypertensive diseases.
More description
DC76837 Ramiprilat diketopiperazine
Ramiprilat diketopiperazine (Ramipril diketopiperazine acid; Impurity K) is an impurity of Ramiprilat. Ramiprilat, an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor.
More description
DC76836 Ramipril diketopiperazine
Ramipril diketopiperazine is an impurity in the ACE inhibitor Ramipril.
More description
DC76835 Quinapril
Quinapril is a potent, orally active, non-peptide and nonsulfhydryl inhibitor of angiotensin-converting enzyme (ACE). Quinapril specifically interrupts the conversion of angiotensin I to angiotensin II in both plasma and tissue. Quinapril is enzymatically hydrolyzed to a pharmacologically active diacid form quinaprilat. Quinapril is efficacious in hypertensive models.
More description
DC76834 Perindopril L-arginine
Perindopril L-arginine is an orally active and selective angiotensin-converting enzyme (ACE) inhibitor. Perindopril L-arginine reduces the production of angiotensin II by inhibiting ACE, thereby dilating blood vessels, lowering blood pressure, and also exerting activities such as vasculoprotection and antithrombosis. Perindopril L-arginine is promising for research of cardiovascular diseases.
More description
DC76833 AD015
AD015 is a angiotensin-converting enzyme (ACE) and neprilysin (NEP) dual inhibitor. AD015 inhibits NEP, nACE and cACE with IC50s of 0.009, 0.019 and 0.0008 μM, respectively.
More description
DC40211 H-Ile-Pro-Pro-OH hydrochloride Featured
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.
More description
DC12262 H-Val-Pro-Pro-OH TFA Featured
H-Val-Pro-Pro-OH (TFA) is a trifluoroacetate (TFA) salt form of the tripeptide H-Val-Pro-Pro-OH, which is derived from milk proteins. This peptide is known for its ability to inhibit Angiotensin I Converting Enzyme (ACE), a key enzyme in the renin-angiotensin system (RAS) that regulates blood pressure. The TFA salt form is commonly used in research and pharmaceutical applications to improve the solubility and stability of the peptide.
More description
DC9325 Cilazapril (monohydrate) Featured
Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
More description
DC72664 Bradykinin potentiator C
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide.
More description
DC72369 RXPA 380
RXPA 380 is a C-terminal specific angiotensin-converting enzyme (ACE) inhibitor with a Ki of 3 nM. RXPA 380 inhibits C-domain mutants of human recombinant ACE with an IC50 of 2.5 nM.
More description
DC72051 Temocapril
Temocapril is an orally active angiotensin-converting enzyme (ACE) inhibitor. Temocapril can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases.
More description
DC71540 Spiraprilat
Spiraprilat is a potent angiotensin-converting enzyme (ACE) inhibitor. Spiraprilat has ability to improve left ventricular (LV) function and metabolism in anesthetized open-chest dogs with acute ventricular failure (ALVF).
More description
DC71171 Moexipril
Moexipril is an orally active and potent angiotensin-converting enzyme (ACE) inhibitor. Moexipril can readily penetrate lipid membranes and thus target plasma and tissue ACE. Moexipril may improve endothelial dysfunction and exert neuroprotective effects. Moexipril can used for cardiovascular disease research.
More description
DC71086 Moveltipril
Moveltipril is a potent angiotensin converting enzyme (ACE) inhibitor.
More description
DC49726 AD013
AD013 is a dual inhibitor of cACE/NEP. AD013 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD013 has the potential for providing the potent antihypertensive and cardioprotective benefits.
More description
DC49725 AD012
AD012 is a dual inhibitor of cACE/NEP. AD012 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD012 has the potential for providing the potent antihypertensive and cardioprotective benefits.
More description
DC49724 AD011
AD011 is a dual inhibitor of cACE/NEP. AD011 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD011 has the potential for providing the potent antihypertensive and cardioprotective benefits.
More description
DC48210 Alacepril
Alacepril (Cetapril) is an orally active angiotensin converting enzyme (ACE) inhibitor with long lasting antihypertensive effect.
More description
DC48209 Fasidotril
Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential treatment of hypertension and congestive heart failure (CHF).
More description
DC12255 MLN-4760 Featured
MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM).
More description
DC47756 Plantainoside D
Plantainoside D shows ACE inhibitory activity with IC50 2.17 mM. And plantainoside D is a promising IKK-β inhibitor.
More description
DC46379 Lyciumin A
Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
More description
DC45903 Camellianin B
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities.
More description
DC45309 (R)-MLN-4760
(R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM).
More description
DC44802 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
More description
DC42520 Spirapril hydrochloride
Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure.
More description
DC41405 Icariside D2
Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
More description

Customized Consultation X

Your information is safe with us. * Required Fields.

Your name
Company
Email
Procuct Name
Cat. No.
Remark
Verification code
Please fill out the characters in the picture
X