To enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.
| Cat. No. | Product Name | Field of Application | Chemical Structure |
|---|---|---|---|
| DC76838 | Rev 6207 free base |
Rev 6207 (free base) is a potent non-thiol angiotensin I converting enzyme inhibitor. Rev 6207 (free base) has comparable antihypertensive activity to Enalapril in awake monkeys with high renin activity and can be used in the study of hypertensive diseases.
More description
|
|
| DC76837 | Ramiprilat diketopiperazine |
Ramiprilat diketopiperazine (Ramipril diketopiperazine acid; Impurity K) is an impurity of Ramiprilat. Ramiprilat, an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor.
More description
|
|
| DC76836 | Ramipril diketopiperazine |
Ramipril diketopiperazine is an impurity in the ACE inhibitor Ramipril.
More description
|
|
| DC76835 | Quinapril |
Quinapril is a potent, orally active, non-peptide and nonsulfhydryl inhibitor of angiotensin-converting enzyme (ACE). Quinapril specifically interrupts the conversion of angiotensin I to angiotensin II in both plasma and tissue. Quinapril is enzymatically hydrolyzed to a pharmacologically active diacid form quinaprilat. Quinapril is efficacious in hypertensive models.
More description
|
|
| DC76834 | Perindopril L-arginine |
Perindopril L-arginine is an orally active and selective angiotensin-converting enzyme (ACE) inhibitor. Perindopril L-arginine reduces the production of angiotensin II by inhibiting ACE, thereby dilating blood vessels, lowering blood pressure, and also exerting activities such as vasculoprotection and antithrombosis. Perindopril L-arginine is promising for research of cardiovascular diseases.
More description
|
|
| DC76833 | AD015 |
AD015 is a angiotensin-converting enzyme (ACE) and neprilysin (NEP) dual inhibitor. AD015 inhibits NEP, nACE and cACE with IC50s of 0.009, 0.019 and 0.0008 μM, respectively.
More description
|
|
| DC40211 | H-Ile-Pro-Pro-OH hydrochloride Featured |
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.
More description
|
|
| DC12262 | H-Val-Pro-Pro-OH TFA Featured |
H-Val-Pro-Pro-OH (TFA) is a trifluoroacetate (TFA) salt form of the tripeptide H-Val-Pro-Pro-OH, which is derived from milk proteins. This peptide is known for its ability to inhibit Angiotensin I Converting Enzyme (ACE), a key enzyme in the renin-angiotensin system (RAS) that regulates blood pressure. The TFA salt form is commonly used in research and pharmaceutical applications to improve the solubility and stability of the peptide.
More description
|
|
| DC9325 | Cilazapril (monohydrate) Featured |
Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
More description
|
|
| DC72664 | Bradykinin potentiator C |
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide.
More description
|
|
| DC72369 | RXPA 380 |
RXPA 380 is a C-terminal specific angiotensin-converting enzyme (ACE) inhibitor with a Ki of 3 nM. RXPA 380 inhibits C-domain mutants of human recombinant ACE with an IC50 of 2.5 nM.
More description
|
|
| DC72051 | Temocapril |
Temocapril is an orally active angiotensin-converting enzyme (ACE) inhibitor. Temocapril can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases.
More description
|
|
| DC71540 | Spiraprilat |
Spiraprilat is a potent angiotensin-converting enzyme (ACE) inhibitor. Spiraprilat has ability to improve left ventricular (LV) function and metabolism in anesthetized open-chest dogs with acute ventricular failure (ALVF).
More description
|
|
| DC71171 | Moexipril |
Moexipril is an orally active and potent angiotensin-converting enzyme (ACE) inhibitor. Moexipril can readily penetrate lipid membranes and thus target plasma and tissue ACE. Moexipril may improve endothelial dysfunction and exert neuroprotective effects. Moexipril can used for cardiovascular disease research.
More description
|
|
| DC71086 | Moveltipril |
Moveltipril is a potent angiotensin converting enzyme (ACE) inhibitor.
More description
|
|
| DC49726 | AD013 |
AD013 is a dual inhibitor of cACE/NEP. AD013 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD013 has the potential for providing the potent antihypertensive and cardioprotective benefits.
More description
|
|
| DC49725 | AD012 |
AD012 is a dual inhibitor of cACE/NEP. AD012 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD012 has the potential for providing the potent antihypertensive and cardioprotective benefits.
More description
|
|
| DC49724 | AD011 |
AD011 is a dual inhibitor of cACE/NEP. AD011 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD011 has the potential for providing the potent antihypertensive and cardioprotective benefits.
More description
|
|
| DC48210 | Alacepril |
Alacepril (Cetapril) is an orally active angiotensin converting enzyme (ACE) inhibitor with long lasting antihypertensive effect.
More description
|
|
| DC48209 | Fasidotril |
Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential treatment of hypertension and congestive heart failure (CHF).
More description
|
|
| DC12255 | MLN-4760 Featured |
MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM).
More description
|
|
| DC47756 | Plantainoside D |
Plantainoside D shows ACE inhibitory activity with IC50 2.17 mM. And plantainoside D is a promising IKK-β inhibitor.
More description
|
|
| DC46379 | Lyciumin A |
Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
More description
|
|
| DC45903 | Camellianin B |
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities.
More description
|
|
| DC45309 | (R)-MLN-4760 |
(R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM).
More description
|
|
| DC44802 | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
More description
|
|
| DC42520 | Spirapril hydrochloride |
Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure.
More description
|
|
| DC41405 | Icariside D2 |
Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
More description
|
|
| DC40003 | BML-111 |
BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties.
More description
|
|
| DC42333 | Vicenin-1 |
Vicenin 1 is a C-glycosylflavone isolated from the aerial parts of Desmodium styracifolium, has any effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM).
More description
|
|