Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

GLP-1(7-36), amide

  Cat. No.:  DC10319   Featured
Chemical Structure
107444-51-9
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86 21 58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.
Cas No.: 107444-51-9
Chemical Name: Glucagon-Like Peptide 1 (7-36) Amide
Synonyms: Glucagon-like peptide I (7-36);GLP-1;GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat);GLP-1(7-36);GLP-1(7-36) amide;Glucagon-like Peptide 1 (7-36) amide;Glucagon-like peptide 1 (7-36) amide (human, rat);GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE;Glucagon-LikePeptideI(7-36),amide,human;GLP-1 (7-36) amide(P1269);HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2;Human GLP-1-(7-36)-amide;Insulinotropin;MKC 253;Preproglucagon 78-107 Amide;UNII-0JS9125PIZ;GLP-1 [7-36];Glp-I (7-36);GLP-1-(7-36) amide;GLP-1(7-36) acetate;GLP-1 (7-36) or (7-37);Human GLP-1 (7-36)-NH2;GLP-1(7-37), IRP peptide;GLP-1 (7-36) AMIDE (HUMAN);GLP-1 (7-36) amide Acetate;GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN;glucagon-likepeptidei(7-36
SMILES: [HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2]
Formula: C149H226N40O45
M.Wt: 3297.63
Purity: >98%
Sotrage: 2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO
Cat. No. Product name Field of application
DC31079 Abarelix Abarelix is a synthetic decapeptide and antagonist of naturally occurring gonadotropin-releasing hormone (GnRH). Abarelix directly and competitively binds to and blocks the gonadotropin releasing hormone receptor in the anterior pituitary gland, thereby inhibiting the secretion and release of luteinizing hormone (LH) and follicle stimulating hormone (FSH). In males, the inhibition of LH secretion prevents the release of testosterone. As a result, this may relieve symptoms associated with prostate hypertrophy or prostate cancer, since testosterone is required to sustain prostate growth.
DC31074 Isopropyl myristate Isopropyl myristate is the ester of isopropyl alcohol and myristic acid.
DC79856 EVT0185 EVT0185 is an orally active ATP citrate lyase (ACLY) inhibitor. EVT0185 is converted to a CoA thioester in the liver by SLC27A2 and interacts with the CoA-binding site of ACLY. EVT0185-CoA inhibits ACLY activity with an IC50 of 2.5 μM. EVT0185 can phenocopy the immune and antitumour effects of genetic ACLY deletion. EVT0185 can increase tumour-infiltrating B cells and chemokine CXCL13 levels. EVT0185 can be used for the research of cancer, such as hepatocellular carcinoma (HCC).
DC79609 NCGC00685960 NCGC00685960 is a Nicotinamide N-methyltransferase (NNMT) inhibitor with an IC50 < 10  nM. NCGC00685960 has potent antitumor activity. NCGC00685960 increases H3K27 trimethylation levels in ovarian cancer cells and inhibits α-SMA expression in NNMT-expressing ovarian fibroblasts. NCGC00685960 reduces 1-MNA levels, reverses SAM and H3K27 hypomethylation and significantly impairs collagen contractility in cancer-associated fibroblasts (CAFs). NCGC00685960 can be used for cancers research.
DC79112 Simepdekinra Simepdekinra (Compound 221) is a IL-17A modulator with IC50s ≤10  nM and 10-100 nM for IL-17A/A HEK-Blue and IL-17A/F HEK-Blue cells. Simepdekinra can be used for inflammatory diseases such as psoriasis, ankylosing spondylitis and psoriatic arthritis research.
DC78751 RSL3-NH2 RSL3-NH2 is a GPX4 inhibitor and Ferroptosis inducer. RSL3-NH2 can be used as a cytotoxic payload for synthesis of antibody-drug conjugates (ADCs).
DC77831 Vicadrostat Vicadrostat (compound 29 A) is a potent and selective inhibitor of aldosterone synthase(CYP11B2) with an IC50 of 16 nM. It exhibits potential in renal disease, diabetic nephropathy, cardiovascular diseases and fibrotic disorder research.
DC77813 Zeltociclib Zeltociclib is a cyclin-dependent kinase inhibitor with antitumor effects.
DC77784 UNC10013 UNC10013 is a SETDB1 allosteric modulator that forms a covalent bond with Cys385 in the 3TD domain, exhibiting negative allosteric regulatory activity. It has a kinact/KI value of 1.0 × 106 M-1*s-1. UNC10013 effectively disrupts SETDB1-mediated Akt methylation and holds potential value for research in cancer and neurodegenerative diseases.
DC77740 T0080 T0080 is a FPR-1 antagonist. T0080 reduces the cell apoptosis, inhibits ROS production and pro-inflammatory cytokines (TNF-α and IL-1β) from plaque macrophages, which attenuates atherosclerotic progression in ApoE−/− mice.
X