Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

GLP-1(7-36), amide

  Cat. No.:  DC10319   Featured
Chemical Structure
107444-51-9
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.
Cas No.: 107444-51-9
Chemical Name: Glucagon-Like Peptide 1 (7-36) Amide
Synonyms: Glucagon-like peptide I (7-36);GLP-1;GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat);GLP-1(7-36);GLP-1(7-36) amide;Glucagon-like Peptide 1 (7-36) amide;Glucagon-like peptide 1 (7-36) amide (human, rat);GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE;Glucagon-LikePeptideI(7-36),amide,human;GLP-1 (7-36) amide(P1269);HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2;Human GLP-1-(7-36)-amide;Insulinotropin;MKC 253;Preproglucagon 78-107 Amide;UNII-0JS9125PIZ;GLP-1 [7-36];Glp-I (7-36);GLP-1-(7-36) amide;GLP-1(7-36) acetate;GLP-1 (7-36) or (7-37);Human GLP-1 (7-36)-NH2;GLP-1(7-37), IRP peptide;GLP-1 (7-36) AMIDE (HUMAN);GLP-1 (7-36) amide Acetate;GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN;glucagon-likepeptidei(7-36
SMILES: [HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2]
Formula: C149H226N40O45
M.Wt: 3297.63
Purity: >98%
Sotrage: 2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO
Cat. No. Product name Field of application
DC31074 Isopropyl myristate Isopropyl myristate is the ester of isopropyl alcohol and myristic acid.
DC75868 AZ14133346 AZ14133346 (compound 36) is a potent and selective inhibitor of EGFR Exon20 insertions, with the IC50 of 85 nM. AZ14133346 plays an important role in cancer research.
DC75865 TI17 ​​TI17​​ represents a novel class of targeted anticancer agents that specifically disrupt DNA damage repair mechanisms in malignant cells.
DC75816 Nisoxetine Nisoxetine acts as a highly selective and potent noradrenaline transporter (NET) antagonist, exhibiting a binding affinity (Kd) of 0.76 nM. In addition to its antidepressant properties, nisoxetine functions as a local anesthetic by inhibiting voltage-gated sodium channels. This dual pharmacological activity makes it a compound of interest for both neurological and pain management research.
DC75641 GENZ-644282 TFA salt Genz-644282, also known as SAR402674, is a non-camptothecin inhibitor of topoisomerase I with potential antineoplastic activity. Topoisomerase I inhibitor Genz-644282 binds to and inhibits the enzyme topoisomerase I, which may result in the inhibition of repair of single-strand DNA breaks, DNA replication, and tumor cell growth in susceptible tumor cell populations.
DC75325 PSMA-617 TFA PSMA-617, also know as vipivotide tetraxetan, is a ligand used to make 177Lu-PSMA-617, which is a radioactive molecule to fight cancer. PSMA617 possesses a small peptide, which was designed to target prostate-specific membrane antigen (PSMA). PSMA617 demonstrates high radiolytic stability for at least 72 h. PSMA617 has high inhibition potency (equilibrium dissociation constant Ki=2.34±2.94 nM on LNCaP; Ki=0.37±0.21 nM enzymatically determined). 177 Lu-PSMA-617 offers a potential additional life-prolonging treatment option for men with mCRPC.
DC75202 Fosaprepitant free acid Fosaprepitant, also known as MK0517, is an antiemetic drug, administered intravenously. It is a prodrug of aprepitant. Fosaprepitant was developed by Merck & Co. and was approved. It is a prodrug of Aprepitant. It aids in the prevention of acute and delayed nausea and vomiting associated with chemotherapy treatment. Fosaprepitant is a weak inhibitor of CYP3A4, and aprepitant, the active moiety, is a substrate, inhibitor, and inducer of CYP3A4
DC74748 O4I4 O4I4 (compound 23) is a OCT4-inducing compound with metabolical stability.
DC74684 ZH8667 ZH8667 is a trace amine-associated receptor 1 (TAAR1)–Gs agonist.
DC74646 EB-PSMA-617 EB-PSMA-617 is an Evans blue-modified prostate-specific membrane antigen (PSMA) 617 ligand for making 177Lu-EB-PSMA, which is potential useful for Metastatic Castration-Resistant Prostate Cancer.
X