Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

GLP-1(7-36), amide

  Cat. No.:  DC10319   Featured
Chemical Structure
107444-51-9
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86 21 58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.
Cas No.: 107444-51-9
Chemical Name: Glucagon-Like Peptide 1 (7-36) Amide
Synonyms: Glucagon-like peptide I (7-36);GLP-1;GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat);GLP-1(7-36);GLP-1(7-36) amide;Glucagon-like Peptide 1 (7-36) amide;Glucagon-like peptide 1 (7-36) amide (human, rat);GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE;Glucagon-LikePeptideI(7-36),amide,human;GLP-1 (7-36) amide(P1269);HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2;Human GLP-1-(7-36)-amide;Insulinotropin;MKC 253;Preproglucagon 78-107 Amide;UNII-0JS9125PIZ;GLP-1 [7-36];Glp-I (7-36);GLP-1-(7-36) amide;GLP-1(7-36) acetate;GLP-1 (7-36) or (7-37);Human GLP-1 (7-36)-NH2;GLP-1(7-37), IRP peptide;GLP-1 (7-36) AMIDE (HUMAN);GLP-1 (7-36) amide Acetate;GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN;glucagon-likepeptidei(7-36
SMILES: [HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2]
Formula: C149H226N40O45
M.Wt: 3297.63
Purity: >98%
Sotrage: 2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO
Cat. No. Product name Field of application
DC31074 Isopropyl myristate Isopropyl myristate is the ester of isopropyl alcohol and myristic acid.
DC79609 NCGC00685960 NCGC00685960 is a Nicotinamide N-methyltransferase (NNMT) inhibitor with an IC50 < 10  nM. NCGC00685960 has potent antitumor activity. NCGC00685960 increases H3K27 trimethylation levels in ovarian cancer cells and inhibits α-SMA expression in NNMT-expressing ovarian fibroblasts. NCGC00685960 reduces 1-MNA levels, reverses SAM and H3K27 hypomethylation and significantly impairs collagen contractility in cancer-associated fibroblasts (CAFs). NCGC00685960 can be used for cancers research.
DC77831 Vicadrostat Vicadrostat (compound 29 A) is a potent and selective inhibitor of aldosterone synthase(CYP11B2) with an IC50 of 16 nM. It exhibits potential in renal disease, diabetic nephropathy, cardiovascular diseases and fibrotic disorder research.
DC77813 Zeltociclib Zeltociclib is a cyclin-dependent kinase inhibitor with antitumor effects.
DC77784 UNC10013 UNC10013 is a SETDB1 allosteric modulator that forms a covalent bond with Cys385 in the 3TD domain, exhibiting negative allosteric regulatory activity. It has a kinact/KI value of 1.0 × 106 M-1*s-1. UNC10013 effectively disrupts SETDB1-mediated Akt methylation and holds potential value for research in cancer and neurodegenerative diseases.
DC77721 SLW131 SLW131 (Compound 10) is the antagonist for CCR7 with a good affinity of Ki of 9.85 nM. SLW131 inhibits CCL19-induced Go protein activation with an IC50 of 29.4 μM, inhibits β-arrestin2 recruitment with an IC50 of 6.0 μM. SLW131 inhibits CCL19-induced cell morphological changes in primary BMDCs, and CCR7-mediated migration in mouse CD4+ T cell.
DC77714 S3226 S3226 is an inhibitor for Na+/H+ exchange subtype 3 (NHE3) with an IC50 of 0.2 µmol/L in rat NHE3 transfected fibroblasts. S3226 exhibits protective activity in rat ischemia-induced acute renal failure models.
DC77387 AUR1545 AUR1545 is a selective degrader of KAT2A and KAT2B. AUR1545 can be used in the cancer research, including studies on AML (Acute myeloid leukemia), SCLC (Small-cell carcinoma), and NEPC (Neuroendocrine Prostate Cancer).
DC77822 JNJ-77242113 (Icotrokinr) Icotrokinra (JNJ-77242113, JNJ-2113, PN-235) is an orally available and selective antagonist of the IL-23 receptor. It also inhibits IL-23–induced STAT3 phosphorylation in peripheral blood mononuclear cells with an IC50 of 5.6 pM and suppresses IL-23–induced IFN-γ production in NK cells with an IC50 of 18.4 pM. It also exhibits anti-inflammatory activity in a TNBS-induced colitis model in rats and holds potential for studying psoriasis, psoriatic arthritis, and inflammatory bowel disease.
DC77088 T025 T025 is as an orally available and potent inhibitor of Cdc2‐like kinases (CLKs) with an IC50s of 0.93 nM, 1 nM, 14 nM, 1.5 nM for CLK1, CLK2, CLK3, DYRK1B respectively. It exhibits anti‐tumor efficacy and can be used in MYC‐driven cancer research.
X