Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

Dulaglutide

  Cat. No.:  A009   Featured
Chemical Structure
923950-08-7
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Dulaglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist that augments glucose-dependent insulin secretion for type 2 diabetes treatment.
Cas No.: 923950-08-7
pH value: Corresponds to reference standard: PASS
Non-reduced CE-SDS: 98.1%
SEC-HPLC: 99.4%
Isoelectric Point: Corresponds to reference standard:PASS
Bacterial Endotoxins Test: <1 EU/ml
Exogenous Residual DNA: <1 pg/mg
Residual protein A: <1 ng/mg
Biological Activity: Compared with standard, the range of biological activity is 103%
Osmolality: Corresponds to reference standard: PASS
Peptide mapping: Corresponds to reference standard: PASS
N-terminal sequence: Corresponds to reference standard:PASS
Description: Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.
Target: GLP-1 receptor[1]
In Vivo: Dulaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist. No specific Dulaglutide-related cause of death is identified. Survival is numerically increased for both genders of animals in all Dulaglutide treatment groups and reaches statistical significance (P≤0.05) in the 0.5- and 5-mg/kg males and in the 0.05-, 0.5-, and 1.5-mg/kg females. Mean times to peak plasma concentration values of Dulaglutide are observed at 12 hours after dosing on day 1 and rang between 12 and 48 hours at week 52. The incidence of thyroid C-cell adenoma is significantly (P≤0.05) increased compare with controls in males and females at the Dulaglutide 0.5-, 1.5-, and 5-mg/kg doses[1].
Animal Administration: The tumorigenic potential of Dulaglutide is evaluated in rats and transgenic mice. Rats are injected sc twice weekly for 93 weeks with Dulaglutide 0, 0.05, 0.5, 1.5, or 5 mg/kg corresponding to 0, 0.5, 7, 20, and 58 times, respectively. Transgenic mice are dosed sc twice weekly with Dulaglutide 0, 0.3, 1, or 3 mg/kg for 26 weeks[1].
References: [1]. Byrd RA, et al. Chronic Toxicity and Carcinogenicity Studies of the Long-Acting GLP-1 Receptor AgonistDulaglutide in Rodents. Endocrinology. 2015 Jul;156(7):2417-28.
Cat. No. Product name Field of application
A1061 Osemitamab Biosimilar(Anti-CLDN18.2 Reference Antibody) Osemitamab is an IgG1 antibody targeting to human claudin-18.2. Osemitamab consists of human-Mus musculus monoclonal TST001 γ1-chain, disulfide with human-Mus musculus monoclonal TST001 κ-chain, dimer (ACI). Osemitamab in combination with Capecitabine (HY-B0016) and Oxaliplatin (HY-17371), can be used for G/GEJ cancer study.
A1060 Muromonab Biosimilar(Anti-CD3 Reference Antibody) Muromonab is a monoclonal antibody targeting the CD3 receptor. Muromonab can block all cytotoxic T cell function. Muromonab also as an immunosuppressant agent given to reduce acute solid organ transplant rejection.
A1059 Atoltivimab Biosimilar(Anti-EBOV Reference Antibody) Atoltivimab (REGN3470), or maftivimab/odesivimab (Inmazeb) is the first Food and agent Administration (FDA)-approved monoclonal antibody to target Zaire ebolavirus (EBOVs) infection.
A1058 Navivumab Biosimilar(Anti-HA Reference Antibody) Navivumab (CT-P23) is an influenza A virus hemagglutinin HA monoclonal antibody. neutralizes H1, H2, H5, and H9 influenza A viruses by binding to the stem fusion domain in HA2.
A1057 Anti-IAV Reference Antibody Biosimilar
A1056 Odesivimab Biosimilar(Anti-Zaire Ebola virus Reference Antibody) Odesivimab is a human monoclonal antibody, targeting Ebola virus glycoprotein with a KD value of 7.74 nM for recombinant histidine-tagged Makona strain Ebola virus glycoprotein ectodomain protein. Odesivimab can be used in research of Ebola virus infection.
A1055 Cosfroviximab Biosimilar(Anti-Zaire Ebola virus Reference Antibody) Cosfroviximab (c13C6-FR1) is a mouse/human chimeric monoclonal antibody against Ebola virus glycoprotein (EBOV-GP).
A1054 Porgaviximab Biosimilar(Anti-Zaire Ebola virus Reference Antibody) Porgaviximab is a monoclonal antibody that can be used Ebola infection research.
A1053 Larcaviximab Biosimilar(Anti-Zaire Ebola virus Reference Antibody) Larcaviximab (c4G7-N) is an IgG1 kappa anti-Ebola virus glycoprotein chimeric monoclonal antibody.
A1052 Romlusevimab Biosimilar(Anti-Spike RBD Reference Antibody) Romlusevimab (BRII-198) is a neutralizing recombinant human IgG1 monoclonal antibody against the spike protein of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
X