Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

Dulaglutide

  Cat. No.:  A009   Featured
Chemical Structure
923950-08-7
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86 21 58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Dulaglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist that augments glucose-dependent insulin secretion for type 2 diabetes treatment.
Cas No.: 923950-08-7
pH value: Corresponds to reference standard: PASS
Non-reduced CE-SDS: 98.1%
SEC-HPLC: 99.4%
Isoelectric Point: Corresponds to reference standard:PASS
Bacterial Endotoxins Test: <1 EU/ml
Exogenous Residual DNA: <1 pg/mg
Residual protein A: <1 ng/mg
Biological Activity: Compared with standard, the range of biological activity is 103%
Osmolality: Corresponds to reference standard: PASS
Peptide mapping: Corresponds to reference standard: PASS
N-terminal sequence: Corresponds to reference standard:PASS
Description: Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.
Target: GLP-1 receptor[1]
In Vivo: Dulaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist. No specific Dulaglutide-related cause of death is identified. Survival is numerically increased for both genders of animals in all Dulaglutide treatment groups and reaches statistical significance (P≤0.05) in the 0.5- and 5-mg/kg males and in the 0.05-, 0.5-, and 1.5-mg/kg females. Mean times to peak plasma concentration values of Dulaglutide are observed at 12 hours after dosing on day 1 and rang between 12 and 48 hours at week 52. The incidence of thyroid C-cell adenoma is significantly (P≤0.05) increased compare with controls in males and females at the Dulaglutide 0.5-, 1.5-, and 5-mg/kg doses[1].
Animal Administration: The tumorigenic potential of Dulaglutide is evaluated in rats and transgenic mice. Rats are injected sc twice weekly for 93 weeks with Dulaglutide 0, 0.05, 0.5, 1.5, or 5 mg/kg corresponding to 0, 0.5, 7, 20, and 58 times, respectively. Transgenic mice are dosed sc twice weekly with Dulaglutide 0, 0.3, 1, or 3 mg/kg for 26 weeks[1].
References: [1]. Byrd RA, et al. Chronic Toxicity and Carcinogenicity Studies of the Long-Acting GLP-1 Receptor AgonistDulaglutide in Rodents. Endocrinology. 2015 Jul;156(7):2417-28.
Cat. No. Product name Field of application
A1105 Zanidatamab Zovodotin
A1104 Tusamitamab ravtansine Tusamitamab ravtansine (SAR-408701) is a targeted ADC against tumor cells expressing CEACAM5, composed of a humanized anti-CEACAM5 monoclonal antibody covalently linked to the potent cytotoxic agent, maytansinoid DM4 (HY-12454), via a cleavable linker. Tusamitamab ravtansine has an average drug-to-antibody ratio (DAR) of 3.8.
A1103 Vadastuximab talirine
A1102 Anetumab Ravtansine Anetumab ravtansine (BAY 94-9343) is a selective and highly potent antibody-drug conjugate (ADC) to target maytansinoid tubulin. Anetumab ravtansine consists of a human anti-mesothelin antibody conjugated to the maytansinoid tubulin inhibitor DM4. Anetumab ravtansine shows antitumor efficacy correlated with the amount of mesothelin expressed in patient-derived xenograft tumor models.
A1101 Mirvetuximab soravtansine Mirvetuximab soravtansine (IMGN853) solution is an anti-folate receptor α (FRα) antibody drug-conjugate (ADC) consisting of the cytotoxic maytansinoid, DM4, covalently linked to the humanized monoclonal antibody M9346A, and the drug-linker conjugate for ADC is sulfo-SPDB-DM4 (HY-101141). Mirvetuximab soravtansine selectively binds to folate receptor 1 (FOLR1). Mirvetuximab soravtansine has an anti-proliferative effect via growth arrest and augmented DNA damage.
A1100 Rovalpituzumab tesirine Rovalpituzumab tesirine (SC-002) is an antibody-drug conjugate (ADC) with anticancer effects. Rovalpituzumab tesirine contains a DLL3-targeting antibody Rovalpituzumab (HY-P99043) tethered to a cytotoxic agent pyrrolobenzodiazepine by means of a protease-cleavable linker. Rovalpituzumab tesirine can be used for the stduy of small cell lung cancer (SCLC).
A1099 Cantuzumab ravtansine Cantuzumab ravtansine (IMGN242; huC242-DM4), an ADC, is a humanized monoclonal antibody, huC242, covalently linked via a disulfide bond to DM4 (HY-12454). Cantuzumab ravtansine has broad antitumor efficacy against a range of CanAg-positive human tumor xenografts.
A1098 Praluzatamab ravtansine
A1097 Labetuzumab govitecan Labetuzumab govitecan (IMMU 130) is an Anti-CEACAM5/SN-38 antibody-drug conjugate (ADC). Labetuzumab govitecan consists of the antibody Labetuzumab, SN-38, and a pH-sensitive Linker. Labetuzumab govitecan can be used for research of cancers, such as colorectal cancer.
A1096 Vorsetuzumab mafodotin Vorsetuzumab mafodotin (SGN-75) is an Auristatin-based anti-CD70 antibody-drug conjugate (ADC). Vorsetuzumab mafodotin consists of a humanized monoclonal antibody, Vorsetuzumab and an ADC cytotoxin MMAF. Vorsetuzumab mafodotin has antineoplastic activity.
X