Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

ELA RR>GG

  Cat. No.:  DC41872  
Chemical Structure
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86 21 58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA.
Cas No.:
Chemical Name: ELA RR>GG
Synonyms: QRPVNLTMGGKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22)
Formula: C162H271N57O39S4
M.Wt: 3769.55
Sotrage: Please store the product under the recommended conditions in the Certificate of Analysis.
Cat. No. Product name Field of application
DC81110 N6-Hydroxynorvalylcarbamoyladenosine N6-Hydroxynorvalylcarbamoyladenosine (hn6A) (compound 1) is a nucleoside discovered in unfractionated tRNA from Thermodesulfobacterium commune. N6-Hydroxynorvalylcarbamoyladenosine is a modified nucleoside.
DC80069 3'-O-(2-Nitrobenzyl)-dTTP 3'-O-(2-Nitrobenzyl)-dTTP acts as a reversible terminator for DNA chain elongation. 3'-O-(2-Nitrobenzyl)-dTTP interacts with 9°N polymerase (exo-) A485L/Y409V, gets recognized and incorporated into the elongating DNA chain, thereby temporarily terminating the polymerase reaction. 3'-O-(2-Nitrobenzyl)-dTTP carries a 3'-O-(2-nitrobenzyl) blocking group, which can be removed by laser irradiation to regenerate the free 3'-OH− group and restore polymerase activity. 3'-O-(2-Nitrobenzyl)-dTTP is applicable in DNA sequencing studies.
DC80060 3-Chloropropan-1-amine hydrochloride 3-Chloropropan-1-amine hydrochloride is a PROTAC linker that can be used in the synthesis of PROTACs.
DC80050 3-(4-Bromophenyl)propanoic acid 3-(4-Bromophenyl)propanoic acid is a PROTAC linker that can be used in the synthesis of PROTACs.
DC80036 2-Bromo-LSD D-Tartrate 2-Bromo-LSD D-Tartrate is a blood-brain barrier-permeable 5-HT2A partial agonist and competitive partial antagonist. 2-Bromo-LSD D-Tartrate acts as both a potent partial agonist (with an EC50 of 0.81 nM for Gq dissociation) and a potent partial antagonist (with a KB of 0.18 nM for Gq dissociation) at the 5-HT2A receptor. 2-Bromo-LSD D-Tartrate exhibits partial agonist activity at multiple aminergic GPCRs, including 5-HT2A. 2-Bromo-LSD D-Tartrate lacks 5-HT2B agonist activity. 2-Bromo-LSD D-Tartrate induces dendritogenesis and spinogenesis. 2-Bromo-LSD D-Tartrate reverses the behavioral effects of chronic stress and increases active coping behaviors in mice.
DC80035 2-Bromo-5-Chloroterephthalic Acid 2-Bromo-5-Chloroterephthalic Acid (2-Bromo-5-chloroterephthalic acid) is a metal-organic framework (MOF).
DC80011 1-Nonadecanoin-2,3-acetyl 1-Nonadecanoin-2,3-acetyl is an acylglycerol.
DC80001 1-Heptanoyl-2,3-diacetyl 1-Heptanoyl-2,3-diacetyl is an acylglycerol.
DC31079 Abarelix Abarelix is a synthetic decapeptide and antagonist of naturally occurring gonadotropin-releasing hormone (GnRH). Abarelix directly and competitively binds to and blocks the gonadotropin releasing hormone receptor in the anterior pituitary gland, thereby inhibiting the secretion and release of luteinizing hormone (LH) and follicle stimulating hormone (FSH). In males, the inhibition of LH secretion prevents the release of testosterone. As a result, this may relieve symptoms associated with prostate hypertrophy or prostate cancer, since testosterone is required to sustain prostate growth.
DC31078 Asulam Asulam is a wild oat herbicide used in prairie regions for control of wild oats in cereal grains such as wheat.
X