To enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.
| Cat. No. | Product Name | Field of Application | Chemical Structure |
|---|---|---|---|
| DC44811 | Questin |
Questin is an antibacterial agent isolated from marine Aspergillus flavipes. Questin exhibits antibacterial activity against V. harveyi, V. anguillarum, V. cholerae, and V. parahemolyticus with MIC values of 31.25 µg/mL, 62.5 µg/mL, 62.5 µg/mL, and 125 µg/mL.
More description
|
|
| DC44810 | Lalistat 1 |
Lalistat 1 is a potent, selective, and competitive inhibitor of lysosomal acid lipase (LAL) and against purified human LAL (phLAL) with an IC50 of 68 nM. Lalistat 1 is a inhibitor of immunoglobulin A1 protease (IgA1P) proteases for H. influenzae, has less effects on other serine hydrolases (trypsin or β-lactamase, etc.). Lalistat 1 can be used for the research of niemann-pick type C (NPC) disease.
More description
|
|
| DC44809 | AUTAC4 |
AUTAC4 is a mitochondria-targeting autophagy-targeting chimera (AUTAC). AUTAC4 downregulates cytosolic proteins and promots targeted mitochondrial turnover via mitophagy.
More description
|
|
| DC44808 | Olaparib D4 |
Olaparib D4 (AZD2281 D4) is the deuterium labeled Olaparib (AZD2281). Olaparib is a potent and orally active PARP inhibitor with IC50s of 5 and 1 nM for PARP1 and PARP2, respectively. Olaparib is an autophagy and mitophagy activator.
More description
|
|
| DC44807 | Clematichinenoside AR |
Clematichinenoside AR is a major active ingredient that could be extracted from the traditional Chinese herb Clematis chinensis and has potent pharmacological effects on various diseases, including atherosclerosis (AS).
More description
|
|
| DC44806 | Sodium Fluoride |
Sodium fluoride (NaF) induces apoptosis and autophagy via the endoplasmic reticulum (ER) stress pathway in MC3T3-E1 osteoblastic cells.
More description
|
|
| DC44805 | (+)-Nortrachelogenin |
(+)-Nortrachelogenin (Wikstromol), a pharmacologically ligand from from wikstroemia indica, possesses antileukemic activity.
More description
|
|
| DC44804 | Monascorubrin |
Monascorubrin is purified from the mycelium of Monascus purpureus. Monascorubrin has significant antibiotic activities against Bacillus subtilis and Candida pseudotropicalis.
More description
|
|
| DC44803 | Caprazamycin |
Caprazamycin is a liponucleoside antibiotic.
More description
|
|
| DC44802 | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
More description
|
|
| DC44801 | Novokinin TFA |
Novokinin TFA is a peptide agonist of the angiotensin AT2 receptor.
More description
|
|
| DC44800 | Angiotensin I/II (1-6) (TFA) |
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy.
More description
|
|
| DC44799 | Angiotensin (1-7) (acetate) |
Angiotensin 1-7 (Ang-(1-7)) acetate is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 acetate inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acetate acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 acetate blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium.
More description
|
|
| DC44797 | Cl-NQTrp |
Cl-NQTrp signifcantly disrupts the preformed fbrillar aggregates of Tau-derived PHF6 (VQIVYK) peptide and full-length tau protein.
More description
|
|
| DC44796 | Beta-Amyloid(1-14),mouse,rat |
Beta-Amyloid(1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide.
More description
|
|
| DC44795 | β-Amyloid (22-40) |
β-Amyloid (22-40) is a peptide fragment of β-Amyloid.
More description
|
|
| DC44794 | β-Amyloid (11-22) |
β-Amyloid (11-22) is a peptide fragment of β-Amyloid.
More description
|
|
| DC44793 | FFN270 hydrochloride |
FFN270 hydrochloride, a fluorescent tracer of norepinephrine, is a fluorescent substrate of the norepinephrine and vesicular monoamine transporters. FFN270 hydrochloride exhibits two resolved absorption/excitation maxima depending on solvent pH (FFN270 ex: 320 nm or 365 nm, em: 475 nm) and can function as ratiometric fluorescent pH-sensors.
More description
|
|
| DC44792 | O-Desmethyl Mebeverine alcohol hydrochloride |
O-Desmethyl Mebeverine alcohol hydrochloride is a metabolite of Mebeverine, which is a potent α1 repector inhibitor, causing relaxation of the gastrointestinal tract.
More description
|
|
| DC44791 | Guanoxabenz hydrochloride |
Guanoxabenz (Hydroxyguanabenz) hydrochloride is an α2 adrenergic receptor agonist, with a Ki of 4000 nM and the fully activated form 40 nM for an α2A adrenoceptor.
More description
|
|
| DC44790 | Ro 363 hydrochloride |
Ro 363 hydrochloride is a potent and highly selective β1-adrenoceptor agonist. Ro 363 hydrochloride is an effective inotropic stimulant, and is a cardiovascular modulator that reduces diastolic blood pressure and pronounces increases in myocardial contractility.
More description
|
|
| DC44789 | TIP 39, Tuberoinfundibular Neuropeptide |
TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R).
More description
|
|
| DC44788 | MP-PEG4-Val-Lys-Gly-7-MAD-MDCPT |
MP-PEG4-Val-Lys-Gly-7-MAD-MDCPT is a Camptothecin-linker compound extracted from patent WO2019195665A1, example 4-1. MP-PEG4-Val-Lys-Gly-7-MAD-MDCPT is a drug-linker conjugate for antibody-drug conjugate (ADC).
More description
|
|
| DC44787 | MP-PEG4-VK(Boc)G-OSu |
MP-PEG4-VK(Boc)G-OSu is a cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs).
More description
|
|
| DC44786 | MC-AAA-NHCH2OCH2COOH |
MC-AAA-NHCH2OCH2COOH (compound 20) is a cleavable ADC linker that is used for making antibody-drug conjugate (ADC).
More description
|
|
| DC44785 | 7-MAD-MDCPT |
7-MAD-MDCPT, a Camptothecin analog, is a toxin payload in antibody drug conjugates (ADCs).
More description
|
|
| DC44784 | MC-AAA-NHCH2OCH2COO-7-aminomethyl-10-methyl-11-fluoro camptothecin |
MC-AAA-NHCH2OCH2COO-7-aminomethyl-10-methyl-11-fluoro camptothecin (compound 21a), a camptothecin payload, can be conjugated to a monoclonal antibody (mAb) for the synthesis of camptothecin antibody-drug conjugate (ADC).
More description
|
|
| DC44782 | O-Desmethyl Galanthamine |
O-Desmethyl Galanthamine (Sanguinine) is galanthamine-type alkaloid. O-Desmethyl Galanthamine is an acetylcholinesterase (AChE) inhibitor, with an IC50 1.83 μM.
More description
|
|
| DC44780 | NPS ALX Compound 4a dihydrochloride |
NPS ALX Compound 4a dihydrochloride is a potent and selective 5-hydroxytryptamine6 (5-HT6) receptor antagonist, with an IC50 of 7.2 nM and a Ki of 0.2 nM.
More description
|
|
| DC44779 | SGS518 oxalate |
SGS518 oxalate is a selective 5-HT6R antagonist. SGS518 oxalate can be used for the research of cognitive impairments such as amnesia, anxiety and depression, and it is effective in protecting mouse retina at high doses[1]
More description
|
|