Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.
Home > Products > Novel inhibitors

Novel inhibitors

You can also try the following methods, and our professionals will serve you Customized Consultation
Cat. No. Product Name Field of Application Chemical Structure
DC44811 Questin
Questin is an antibacterial agent isolated from marine Aspergillus flavipes. Questin exhibits antibacterial activity against V. harveyi, V. anguillarum, V. cholerae, and V. parahemolyticus with MIC values of 31.25 µg/mL, 62.5 µg/mL, 62.5 µg/mL, and 125 µg/mL.
More description
DC44810 Lalistat 1
Lalistat 1 is a potent, selective, and competitive inhibitor of lysosomal acid lipase (LAL) and against purified human LAL (phLAL) with an IC50 of 68 nM. Lalistat 1 is a inhibitor of immunoglobulin A1 protease (IgA1P) proteases for H. influenzae, has less effects on other serine hydrolases (trypsin or β-lactamase, etc.). Lalistat 1 can be used for the research of niemann-pick type C (NPC) disease.
More description
DC44809 AUTAC4
AUTAC4 is a mitochondria-targeting autophagy-targeting chimera (AUTAC). AUTAC4 downregulates cytosolic proteins and promots targeted mitochondrial turnover via mitophagy.
More description
DC44808 Olaparib D4
Olaparib D4 (AZD2281 D4) is the deuterium labeled Olaparib (AZD2281). Olaparib is a potent and orally active PARP inhibitor with IC50s of 5 and 1 nM for PARP1 and PARP2, respectively. Olaparib is an autophagy and mitophagy activator.
More description
DC44807 Clematichinenoside AR
Clematichinenoside AR is a major active ingredient that could be extracted from the traditional Chinese herb Clematis chinensis and has potent pharmacological effects on various diseases, including atherosclerosis (AS).
More description
DC44806 Sodium Fluoride
Sodium fluoride (NaF) induces apoptosis and autophagy via the endoplasmic reticulum (ER) stress pathway in MC3T3-E1 osteoblastic cells.
More description
DC44805 (+)-Nortrachelogenin
(+)-Nortrachelogenin (Wikstromol), a pharmacologically ligand from from wikstroemia indica, possesses antileukemic activity.
More description
DC44804 Monascorubrin
Monascorubrin is purified from the mycelium of Monascus purpureus. Monascorubrin has significant antibiotic activities against Bacillus subtilis and Candida pseudotropicalis.
More description
DC44803 Caprazamycin
Caprazamycin is a liponucleoside antibiotic.
More description
DC44802 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
More description
DC44801 Novokinin TFA
Novokinin TFA is a peptide agonist of the angiotensin AT2 receptor.
More description
DC44800 Angiotensin I/II (1-6) (TFA)
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy.
More description
DC44799 Angiotensin (1-7) (acetate)
Angiotensin 1-7 (Ang-(1-7)) acetate is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 acetate inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acetate acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 acetate blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium.
More description
DC44797 Cl-NQTrp
Cl-NQTrp signifcantly disrupts the preformed fbrillar aggregates of Tau-derived PHF6 (VQIVYK) peptide and full-length tau protein.
More description
DC44796 Beta-Amyloid(1-14),mouse,rat
Beta-Amyloid(1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide.
More description
DC44795 β-Amyloid (22-40)
β-Amyloid (22-40) is a peptide fragment of β-Amyloid.
More description
DC44794 β-Amyloid (11-22)
β-Amyloid (11-22) is a peptide fragment of β-Amyloid.
More description
DC44793 FFN270 hydrochloride
FFN270 hydrochloride, a fluorescent tracer of norepinephrine, is a fluorescent substrate of the norepinephrine and vesicular monoamine transporters. FFN270 hydrochloride exhibits two resolved absorption/excitation maxima depending on solvent pH (FFN270 ex: 320 nm or 365 nm, em: 475 nm) and can function as ratiometric fluorescent pH-sensors.
More description
DC44792 O-Desmethyl Mebeverine alcohol hydrochloride
O-Desmethyl Mebeverine alcohol hydrochloride is a metabolite of Mebeverine, which is a potent α1 repector inhibitor, causing relaxation of the gastrointestinal tract.
More description
DC44791 Guanoxabenz hydrochloride
Guanoxabenz (Hydroxyguanabenz) hydrochloride is an α2 adrenergic receptor agonist, with a Ki of 4000 nM and the fully activated form 40 nM for an α2A adrenoceptor.
More description
DC44790 Ro 363 hydrochloride
Ro 363 hydrochloride is a potent and highly selective β1-adrenoceptor agonist. Ro 363 hydrochloride is an effective inotropic stimulant, and is a cardiovascular modulator that reduces diastolic blood pressure and pronounces increases in myocardial contractility.
More description
DC44789 TIP 39, Tuberoinfundibular Neuropeptide
TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R).
More description
DC44788 MP-PEG4-Val-Lys-Gly-7-MAD-MDCPT
MP-PEG4-Val-Lys-Gly-7-MAD-MDCPT is a Camptothecin-linker compound extracted from patent WO2019195665A1, example 4-1. MP-PEG4-Val-Lys-Gly-7-MAD-MDCPT is a drug-linker conjugate for antibody-drug conjugate (ADC).
More description
DC44787 MP-PEG4-VK(Boc)G-OSu
MP-PEG4-VK(Boc)G-OSu is a cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs).
More description
DC44786 MC-AAA-NHCH2OCH2COOH
MC-AAA-NHCH2OCH2COOH (compound 20) is a cleavable ADC linker that is used for making antibody-drug conjugate (ADC).
More description
DC44785 7-MAD-MDCPT
7-MAD-MDCPT, a Camptothecin analog, is a toxin payload in antibody drug conjugates (ADCs).
More description
DC44784 MC-AAA-NHCH2OCH2COO-7-aminomethyl-10-methyl-11-fluoro camptothecin
MC-AAA-NHCH2OCH2COO-7-aminomethyl-10-methyl-11-fluoro camptothecin (compound 21a), a camptothecin payload, can be conjugated to a monoclonal antibody (mAb) for the synthesis of camptothecin antibody-drug conjugate (ADC).
More description
DC44782 O-Desmethyl Galanthamine
O-Desmethyl Galanthamine (Sanguinine) is galanthamine-type alkaloid. O-Desmethyl Galanthamine is an acetylcholinesterase (AChE) inhibitor, with an IC50 1.83 μM.
More description
DC44780 NPS ALX Compound 4a dihydrochloride
NPS ALX Compound 4a dihydrochloride is a potent and selective 5-hydroxytryptamine6 (5-HT6) receptor antagonist, with an IC50 of 7.2 nM and a Ki of 0.2 nM.
More description
DC44779 SGS518 oxalate
SGS518 oxalate is a selective 5-HT6R antagonist. SGS518 oxalate can be used for the research of cognitive impairments such as amnesia, anxiety and depression, and it is effective in protecting mouse retina at high doses[1]
More description

Customized Consultation X

Your information is safe with us. * Required Fields.

Your name
Company
Email
Procuct Name
Cat. No.
Remark
Verification code
Please fill out the characters in the picture
X