Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

Deserpidine

  Cat. No.:  DC28193  
Chemical Structure
131-01-1
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex.
Cas No.: 131-01-1
Formula: C32H38N2O8
M.Wt: 578.65
Sotrage: 2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO
Cat. No. Product name Field of application
DC47756 Plantainoside D Plantainoside D shows ACE inhibitory activity with IC50 2.17 mM. And plantainoside D is a promising IKK-β inhibitor.
DC46379 Lyciumin A Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
DC45903 Camellianin B Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities.
DC45309 (R)-MLN-4760 (R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM).
DC44802 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
DC42520 Spirapril hydrochloride Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure.
DC42333 Vicenin-1 Vicenin 1 is a C-glycosylflavone isolated from the aerial parts of Desmodium styracifolium, has any effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM).
DC41405 Icariside D2 Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
DC40003 BML-111 BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties.
DC29151 DX600 TFA DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE.
X