Icariside D2|CAS 38954-02-8|DC Chemicals

Cas No.:	38954-02-8
Chemical Name:	Icariside D2
SMILES:	O[C@H]1[C@H](OC2=CC=C(CCO)C=C2)O[C@H](CO)[C@@H](O)[C@@H]1O
Formula:	C₁₄H₂₀O₇
M.Wt:	300.3
Sotrage:	Please store the product under the recommended conditions in the Certificate of Analysis.

Cat. No.	Product name	Field of application
DC47756	Plantainoside D	Plantainoside D shows ACE inhibitory activity with IC50 2.17 mM. And plantainoside D is a promising IKK-β inhibitor.
DC46379	Lyciumin A	Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
DC45903	Camellianin B	Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities.
DC45309	(R)-MLN-4760	(R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM).
DC44802	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
DC42520	Spirapril hydrochloride	Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure.
DC42333	Vicenin-1	Vicenin 1 is a C-glycosylflavone isolated from the aerial parts of Desmodium styracifolium, has any effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM).
DC41405	Icariside D2	Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
DC40003	BML-111	BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties.
DC29151	DX600 TFA	DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE.