Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.

Spirapril hydrochloride

  Cat. No.:  DC42520  
Chemical Structure
94841-17-5
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure.
Cas No.: 94841-17-5
Synonyms: Spirapril hydrochloride
SMILES: O=C([C@H](C1)N(C([C@@H](N[C@H](C(OCC)=O)CCC2=CC=CC=C2)C)=O)CC31SCCS3)O.[H]Cl
Formula: C22H31ClN2O5S2
M.Wt: 503.07
Sotrage: Please store the product under the recommended conditions in the Certificate of Analysis.
Cat. No. Product name Field of application
DC47756 Plantainoside D Plantainoside D shows ACE inhibitory activity with IC50 2.17 mM. And plantainoside D is a promising IKK-β inhibitor.
DC46379 Lyciumin A Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
DC45903 Camellianin B Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities.
DC45309 (R)-MLN-4760 (R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM).
DC44802 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
DC42520 Spirapril hydrochloride Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure.
DC42333 Vicenin-1 Vicenin 1 is a C-glycosylflavone isolated from the aerial parts of Desmodium styracifolium, has any effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM).
DC41405 Icariside D2 Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
DC40003 BML-111 BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties.
DC29151 DX600 TFA DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE.
X