Alternate TextTo enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.
Home > Inhibitors & Agonists > Metabolic Enzyme/Protease

Metabolic Enzyme/Protease

You can also try the following methods, and our professionals will serve you Customized Consultation
Cat. No. Product Name Field of Application Chemical Structure
DC44964 Glicoricone
Glicoricone, a phenolic compound, is isolated from a species of licorice. Glicoricone is an inhibitor of monoamine oxidase (MAO), with an IC50 of 140 μM. Glicoricone binds to estrogen receptor (ER) and shows estrogen antagonist activity.
More description
DC44963 N-Arachidonyl maleimide
N-Arachidonyl maleimide is a potent, irreversible inhibitor of monoacylglycerol lipase (MAGL) with an IC50 value of 140 nM.
More description
DC44916 Guanylate cyclase-IN-1
Guanylate cyclase-IN-1 (Example 46) is a guanylate cyclase inhibitor that can be used for cardiovascular diseases research.
More description
DC44914 Tangshenoside I
Tangshenoside I, isolated from the roots of Codonopsis lanceolata, exhibits weak α-glucosidase inhibitory activities in vitro with an IC50 of 1.4 mM.
More description
DC44902 Alkaline phosphatase
Alkaline phosphatase is a membrane-bound glycoprotein that catalyzes the hydrolysis of phosphate monoesters at basic pH values. Alkaline phosphatase can be used for molecular biology and enzyme immunoassay.
More description
DC44901 Taurohyodeoxycholic acid
Taurohyodeoxycholic acid is the tauroconjugated form of Hyodeoxycholic acid (HDCA, a dihydroxylated natural bile acid). Taurohyodeoxycholic acid induces a biliary phospholipid secretion and suggests a hepatoprotective potential. Taurohyodeoxycholic acid also can promote gallstone dissolution.
More description
DC44900 Myristelaidic acid
Myristelaidic acid (trans-9-Tetradecenoic acid), a 14-carbon trans fatty acid, is the trans isomer of Myristoleic acid. Myristelaidic acid is found in most animal fats.
More description
DC44899 3,5-Dimethylbenzaldehyde
3,5-Dimethylbenzaldehyde is a building block in the chemical synthesis.
More description
DC44898 Sodium 3-methyl-2-oxobutanoate
Sodium 3-methyl-2-oxobutanoate is a precursor of pantothenic acid in Escherichia coli.
More description
DC44896 OMDM-2
OMDM-2 is a potent, selective and metabolically stable inhibitor of anandamide cellular uptake (ACU), with a Ki of 3.0 μM.
More description
DC44895 OMDM-1
OMDM-1 is a potent, selective and metabolically stable inhibitor of anandamide cellular uptake (ACU), with a Ki of 2.4 μM.
More description
DC44894 Orotidine
Orotidine, a nucleotide, is an intermediate in pyrimidine nucleotide biosynthesis in RNA and DNA. Orotidine is mainly found in bacteria, fungi and plants.
More description
DC44853 16α-Hydroxyprednisolone
16α-Hydroxyprednisolone is a stereoselective metabolite of the 22(R) epimer of the glucocorticoid budesonide via cytochrome P450 3A (CYP3A) enzymes.
More description
DC44844 Retagliptin
Retagliptin (SP2086) is a selective, competitive and orally active dipeptidyl peptidase-4 (DPP-4) inhibitor. Retagliptin can be used for type 2 diabetes mellitus (T2DM) research.
More description
DC44802 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
More description
DC44789 TIP 39, Tuberoinfundibular Neuropeptide
TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R).
More description
DC44782 O-Desmethyl Galanthamine
O-Desmethyl Galanthamine (Sanguinine) is galanthamine-type alkaloid. O-Desmethyl Galanthamine is an acetylcholinesterase (AChE) inhibitor, with an IC50 1.83 μM.
More description
DC44761 Vardenafil hydrochloride
Vardenafil (BAY38-9456, Levitra, Staxyn) hydrochloride is a selective, orally active, potent inhibitor of phosphodiesterase (PDE) with IC50 of 0.7 nM, 11 nM and 180 nM for PDE5, PDE6 and PDE1, respectively.
More description
DC44758 Pseudocoptisine chloride
Pseudocoptisine (Isocoptisine) chloride is a quaternary alkaloid with benzylisoquinoline skeleton, was isolated from Corydalis Tuber. Pseudocoptisine chloride inhibits acetylcholinesterase (AChE) activity with an IC50 of 12.8 μM. Anti-inflammatory and ant
More description
DC44756 Iproniazid phosphate
Iproniazid (Marsilid, Iprazid) phosphate is a non-selective, irreversible monoamine oxidase (MAO) inhibitor (MAOI) that is used as an antidepressive agent.
More description
DC44755 Isomalt
Isomalt (Palatinitol) is a sugar alcohol used as an excipient in commercially available solid oral dosage forms. Isomalt stabilizes lactate dehydrogenase (LDH) moderately during freeze-drying.
More description
DC44583 Ilexoside O
Ilexoside O is a triterpene saponin isolated from the roots of Ilex pubescens. Ilexoside O exhibits weak xanthine oxidase (XOD) inhibitory activity (IC50=53.05 μM).
More description
DC44582 PCPA methyl ester hydrochloride
PCPA methyl ester hydrochloride (4-Chloro-DL-phenylalanine methyl ester hydrochloride), a reversible tryptophan hydroxylase inhibitor, is a serotonin (5-HT) synthesis inhibitor. PCPA methyl ester hydrochloride crosses the blood brain barrier and reduces 5
More description
DC44581 Thioquinapiperifil
Thioquinapiperifil (KF31327 free base), a potent, selective and non-competitive phosphodiesterase-5 (PDE-5, IC50 of 0.074 nM) inhibitor, is used for sexual enhancement study.
More description
DC44579 Uralenol
Uralenol is a natural PTP1B inhibitor (IC50=21. 5 μM) from Broussonetia papyrifera. PTP1B have been shown to play a major role in the dephosphorylation of the insulin receptor in many cellular and biochemical studies.
More description
DC44578 GKA50 quarterhydrate
GKA50 quarterhydrate is a potent glucokinase activator (EC50=33 nM at 5 mM glucose). GKA50 quarterhydrate stimulates insulin release from mouse islets of Langerhans and MIN6 cells. GKA50 quarterhydrate shows significant glucose lowering in high fat fed fe
More description
DC44577 trans-Chalcone
trans-Chalcone, isolated from Aronia melanocarpa skin, is a biphenolic core structure of flavonoids precursor. trans-Chalcone is a potent fatty acid synthase (FAS) and α-amylase inhibitor. trans-Chalcone causes cellcycle arrest and induces apoptosis in th
More description
DC44576 FTI-2153 TFA
FTI-2153 TFA is a potent and highly selective inhibitor of farnesyltransferase (FTase), with an IC50 of 1.4 nM. FTI-2153 TFA is >3000-fold more potent at blocking H-Ras (IC50, 10 nM) than Rap1A processing. Anti-cancer activity.
More description
DC44575 5β-Dihydrocortisone
5β-Dihydrocortisone is a sterol metabolite of cortisone by 5β-reductase (AKR1D1) in liver.
More description
DC44574 Gamma-glutamylcysteine
Gamma-glutamylcysteine (γ-Glutamylcysteine), a dipeptide containing cysteine and glutamic acid, is a precursor to glutathione (GSH). Gamma-glutamylcysteine is a cofactor for glutathione peroxidase (GPx) to increase GSH levels.
More description

Customized Consultation X

Your information is safe with us. * Required Fields.

Your name
Company
Email
Procuct Name
Cat. No.
Remark
Verification code
Please fill out the characters in the picture
X