To enhance service speed and avoid tariff delays, we've opened a US warehouse. All US orders ship directly from our US facility.
| Cat. No. | Product Name | Field of Application | Chemical Structure |
|---|---|---|---|
| DC44964 | Glicoricone |
Glicoricone, a phenolic compound, is isolated from a species of licorice. Glicoricone is an inhibitor of monoamine oxidase (MAO), with an IC50 of 140 μM. Glicoricone binds to estrogen receptor (ER) and shows estrogen antagonist activity.
More description
|
|
| DC44963 | N-Arachidonyl maleimide |
N-Arachidonyl maleimide is a potent, irreversible inhibitor of monoacylglycerol lipase (MAGL) with an IC50 value of 140 nM.
More description
|
|
| DC44916 | Guanylate cyclase-IN-1 |
Guanylate cyclase-IN-1 (Example 46) is a guanylate cyclase inhibitor that can be used for cardiovascular diseases research.
More description
|
|
| DC44914 | Tangshenoside I |
Tangshenoside I, isolated from the roots of Codonopsis lanceolata, exhibits weak α-glucosidase inhibitory activities in vitro with an IC50 of 1.4 mM.
More description
|
|
| DC44902 | Alkaline phosphatase |
Alkaline phosphatase is a membrane-bound glycoprotein that catalyzes the hydrolysis of phosphate monoesters at basic pH values. Alkaline phosphatase can be used for molecular biology and enzyme immunoassay.
More description
|
|
| DC44901 | Taurohyodeoxycholic acid |
Taurohyodeoxycholic acid is the tauroconjugated form of Hyodeoxycholic acid (HDCA, a dihydroxylated natural bile acid). Taurohyodeoxycholic acid induces a biliary phospholipid secretion and suggests a hepatoprotective potential. Taurohyodeoxycholic acid also can promote gallstone dissolution.
More description
|
|
| DC44900 | Myristelaidic acid |
Myristelaidic acid (trans-9-Tetradecenoic acid), a 14-carbon trans fatty acid, is the trans isomer of Myristoleic acid. Myristelaidic acid is found in most animal fats.
More description
|
|
| DC44899 | 3,5-Dimethylbenzaldehyde |
3,5-Dimethylbenzaldehyde is a building block in the chemical synthesis.
More description
|
|
| DC44898 | Sodium 3-methyl-2-oxobutanoate |
Sodium 3-methyl-2-oxobutanoate is a precursor of pantothenic acid in Escherichia coli.
More description
|
|
| DC44896 | OMDM-2 |
OMDM-2 is a potent, selective and metabolically stable inhibitor of anandamide cellular uptake (ACU), with a Ki of 3.0 μM.
More description
|
|
| DC44895 | OMDM-1 |
OMDM-1 is a potent, selective and metabolically stable inhibitor of anandamide cellular uptake (ACU), with a Ki of 2.4 μM.
More description
|
|
| DC44894 | Orotidine |
Orotidine, a nucleotide, is an intermediate in pyrimidine nucleotide biosynthesis in RNA and DNA. Orotidine is mainly found in bacteria, fungi and plants.
More description
|
|
| DC44853 | 16α-Hydroxyprednisolone |
16α-Hydroxyprednisolone is a stereoselective metabolite of the 22(R) epimer of the glucocorticoid budesonide via cytochrome P450 3A (CYP3A) enzymes.
More description
|
|
| DC44844 | Retagliptin |
Retagliptin (SP2086) is a selective, competitive and orally active dipeptidyl peptidase-4 (DPP-4) inhibitor. Retagliptin can be used for type 2 diabetes mellitus (T2DM) research.
More description
|
|
| DC44802 | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
More description
|
|
| DC44789 | TIP 39, Tuberoinfundibular Neuropeptide |
TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R).
More description
|
|
| DC44782 | O-Desmethyl Galanthamine |
O-Desmethyl Galanthamine (Sanguinine) is galanthamine-type alkaloid. O-Desmethyl Galanthamine is an acetylcholinesterase (AChE) inhibitor, with an IC50 1.83 μM.
More description
|
|
| DC44761 | Vardenafil hydrochloride |
Vardenafil (BAY38-9456, Levitra, Staxyn) hydrochloride is a selective, orally active, potent inhibitor of phosphodiesterase (PDE) with IC50 of 0.7 nM, 11 nM and 180 nM for PDE5, PDE6 and PDE1, respectively.
More description
|
|
| DC44758 | Pseudocoptisine chloride |
Pseudocoptisine (Isocoptisine) chloride is a quaternary alkaloid with benzylisoquinoline skeleton, was isolated from Corydalis Tuber. Pseudocoptisine chloride inhibits acetylcholinesterase (AChE) activity with an IC50 of 12.8 μM. Anti-inflammatory and ant
More description
|
|
| DC44756 | Iproniazid phosphate |
Iproniazid (Marsilid, Iprazid) phosphate is a non-selective, irreversible monoamine oxidase (MAO) inhibitor (MAOI) that is used as an antidepressive agent.
More description
|
|
| DC44755 | Isomalt |
Isomalt (Palatinitol) is a sugar alcohol used as an excipient in commercially available solid oral dosage forms. Isomalt stabilizes lactate dehydrogenase (LDH) moderately during freeze-drying.
More description
|
|
| DC44583 | Ilexoside O |
Ilexoside O is a triterpene saponin isolated from the roots of Ilex pubescens. Ilexoside O exhibits weak xanthine oxidase (XOD) inhibitory activity (IC50=53.05 μM).
More description
|
|
| DC44582 | PCPA methyl ester hydrochloride |
PCPA methyl ester hydrochloride (4-Chloro-DL-phenylalanine methyl ester hydrochloride), a reversible tryptophan hydroxylase inhibitor, is a serotonin (5-HT) synthesis inhibitor. PCPA methyl ester hydrochloride crosses the blood brain barrier and reduces 5
More description
|
|
| DC44581 | Thioquinapiperifil |
Thioquinapiperifil (KF31327 free base), a potent, selective and non-competitive phosphodiesterase-5 (PDE-5, IC50 of 0.074 nM) inhibitor, is used for sexual enhancement study.
More description
|
|
| DC44579 | Uralenol |
Uralenol is a natural PTP1B inhibitor (IC50=21. 5 μM) from Broussonetia papyrifera. PTP1B have been shown to play a major role in the dephosphorylation of the insulin receptor in many cellular and biochemical studies.
More description
|
|
| DC44578 | GKA50 quarterhydrate |
GKA50 quarterhydrate is a potent glucokinase activator (EC50=33 nM at 5 mM glucose). GKA50 quarterhydrate stimulates insulin release from mouse islets of Langerhans and MIN6 cells. GKA50 quarterhydrate shows significant glucose lowering in high fat fed fe
More description
|
|
| DC44577 | trans-Chalcone |
trans-Chalcone, isolated from Aronia melanocarpa skin, is a biphenolic core structure of flavonoids precursor. trans-Chalcone is a potent fatty acid synthase (FAS) and α-amylase inhibitor. trans-Chalcone causes cellcycle arrest and induces apoptosis in th
More description
|
|
| DC44576 | FTI-2153 TFA |
FTI-2153 TFA is a potent and highly selective inhibitor of farnesyltransferase (FTase), with an IC50 of 1.4 nM. FTI-2153 TFA is >3000-fold more potent at blocking H-Ras (IC50, 10 nM) than Rap1A processing. Anti-cancer activity.
More description
|
|
| DC44575 | 5β-Dihydrocortisone |
5β-Dihydrocortisone is a sterol metabolite of cortisone by 5β-reductase (AKR1D1) in liver.
More description
|
|
| DC44574 | Gamma-glutamylcysteine |
Gamma-glutamylcysteine (γ-Glutamylcysteine), a dipeptide containing cysteine and glutamic acid, is a precursor to glutathione (GSH). Gamma-glutamylcysteine is a cofactor for glutathione peroxidase (GPx) to increase GSH levels.
More description
|
|