GLP-1(7-36), amide TFA|CAS 0|DC Chemicals

Cas No.:
Chemical Name:	GLP-1(7-36), amide TFA
Synonyms:	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2
Formula:	C₁₅₁H₂₂₇F₃N₄₀O₄₇
M.Wt:	3411.65
Sotrage:	Protect from lightPowder-80°C2 years-20°C1 year*In solvent : -80°C, 6 months; -20°C, 1 month (protect from light)

Cat. No.	Product name	Field of application
DC47637	GLP-1R modulator C16	GLP-1R modulator C16 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC50 8.43 ± 3.82 μM).
DC47636	GLP-1R modulator C5	GLP-1R modulator C5 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC50 1.59 ± 0.53 μM).
DC42498	GLP-1(28-36)amide	GLP-1(28-36)amide, a C-terminal nonapeptide of GLP-1, is a major product derived from the cleavage of GLP-1 by the neutral endopeptidase (NEP). GLP-1(28-36)amide is an antioxidant and targets to mitochondrion, inhibits mitochondrial permeability transition (MPT). GLP-1(28-36)amide has anti-diabetic and cardioprotection effects.
DC42497	GLP-1(28-36)amide TFA	GLP-1(28-36)amide TFA, a C-terminal nonapeptide of GLP-1, is a major product derived from the cleavage of GLP-1 by the neutral endopeptidase (NEP). GLP-1(28-36)amide TFA is an antioxidant and targets to mitochondrion, inhibits mitochondrial permeability transition (MPT). GLP-1(28-36)amide TFA has anti-diabetic and cardioprotection effects.
DC42496	GLP-1(32-36)amide	GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice.
DC42495	GLP-1(32-36)amide TFA	GLP-1(32-36)amide TFA, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide TFA could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice.
DC42067	GLP-2(3-33)	GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
DC41999	Exendin (5-39)	Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.
DC41621	Bay 55-9837 TFA	Bay 55-9837 TFA is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 TFA may be a useful therapy for the research of type 2 diabetes.
DC41620	Bay 55-9837	Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes.