PHM-27 (human)|CAS 118025-43-7|DC Chemicals

Cas No.:	118025-43-7
Chemical Name:	PHM-27 (human)
Synonyms:	HADGVFTSDFSKLLGQLSAKKYLESLM-NH2
Formula:	C₁₃₅H₂₁₄N₃₄O₄₀S
M.Wt:	2985.41
Sotrage:	Please store the product under the recommended conditions in the Certificate of Analysis.

Cat. No.	Product name	Field of application
DC41849	Adrenomedullin (16-31), human TFA	Adrenomedullin (16-31), human TFA is amino acid residues 16-31 fragment of human adrenomedullin (hADM). Adrenomedullin has appreciable affinity for the CGRP1 receptor. Adrenomedullin (16-31), human TFA possesses pressor activity in the systemic vascular bed of the rat, but not the cat.
DC41560	PHM-27 (human)	PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism.
DC29116	Adrenomedullin (AM) (22-52), human TFA	Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
DC10370	Olcegepant hydrochloride	Olcegepant hydrochloride is the first potent and selective non-peptide antagonist of the calcitonin gene-related peptide 1 (CGRP1) receptor with IC50 of 0.03 nM and with a Ki of 14.4 pM for human CGRP.
DC9397	MK-3207 (Hydrochloride)	MK-3207 is a potent and orally bioavailable CGRP receptor antagonist (IC50= 0.12 nM; Ki value= 0.024 nM); highly selective versus human AM1, AM2, CTR, and AMY3.