PHM-27 (human)|CAS 118025-43-7|DC Chemicals

Cas No.:	118025-43-7
Chemical Name:	PHM-27 (human)
Synonyms:	HADGVFTSDFSKLLGQLSAKKYLESLM-NH2
Formula:	C₁₃₅H₂₁₄N₃₄O₄₀S
M.Wt:	2985.41
Sotrage:	Please store the product under the recommended conditions in the Certificate of Analysis.

Cat. No.	Product name	Field of application
DC41881	Calcitonin (human)	Calcitonin human is an endogenous calcitonin receptor agonist.Calcitonin human lowers systemic blood calcium levels and inhibits bone resorption.
DC41849	Adrenomedullin (16-31), human TFA	Adrenomedullin (16-31), human TFA is amino acid residues 16-31 fragment of human adrenomedullin (hADM). Adrenomedullin has appreciable affinity for the CGRP1 receptor. Adrenomedullin (16-31), human TFA possesses pressor activity in the systemic vascular bed of the rat, but not the cat.
DC41560	PHM-27 (human)	PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism.
DC29116	Adrenomedullin (AM) (22-52), human TFA	Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
DC10370	Olcegepant hydrochloride	Olcegepant hydrochloride is the first potent and selective non-peptide antagonist of the calcitonin gene-related peptide 1 (CGRP1) receptor with IC50 of 0.03 nM and with a Ki of 14.4 pM for human CGRP.
DC9397	MK-3207 (Hydrochloride)	MK-3207 is a potent and orally bioavailable CGRP receptor antagonist (IC50= 0.12 nM; Ki value= 0.024 nM); highly selective versus human AM1, AM2, CTR, and AMY3.