VPM peptide TFA is a dithiol protease-cleavable peptide cross-linker. VPM peptide TFA can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel.

Obestatin(human) is an endogenous peptide derived from the same prepropeptide as ghrelin. Obestatin(human) suppresses food intake and reduce body weight-gain in rats.

MCA-SEVNLDAEFR-K(Dnp)-RR, amide is a FRET-based substrate.

TCS 184 is a polypeptide fragment.

Hsp70-derived octapeptide is a conserved octapeptide of the C-terminal end of Hsp70, which physically interacts with tetratricopeptide repeat (TPR) motifs.

Bim BH3, Peptide IV is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins.

TCTDSTNCYKAT is an engineered-variant peptide of antifreeze protein (AFP).

BDC2.5 mimotope 1040-31, a BDC2.5 TCR reactive peptide, is a strong agonistic peptide for diabetogenic T cell clone BDC2.5, and the 1040-31 peptide is specific for BDC 2.5 TCR Tg+ T cells.

Chemerin-9 (149-157), the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR.

TLQP-30 is a VGF peptide.

NY-BR-1 p904 (A2) is an HLA-A2-restricted NY-BR-1 epitope. T-cell clone specific for NY-BR-1 p904 can recognize breast tumor cells expressing NY-BR-1.

JAG-1, scrambled is a scrambled sequence of JAG-1. JAG-1, scrambled with a random sequence of the amino acids that are the same as the active fragment. JAG-1, scrambled usually used as a negative control.

HIF-1 alpha (556-574) is a short hypoxia-inducible factor-1 (HIF-1) 19 residues fragment. HIF-1 functions as master regulator of response to oxygen homeostasis.

AGA-(C8R) HNG17, Humanin derivative is a potent humanin (HN) derivative. AGA-(C8R) HNG17, Humanin derivative completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.

Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay.

LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research.

DL-Penicillamine (DL-beta-Mercaptovaline, 3,3-Dimethyl-DL-cysteine, 3-Sulfanylvaline, Cuprimine, Depen, DL-PenA, DL-P) induces alteration of elastic fibers of periosteum-perichondrium and associates growth inhibition.

PBDB-T is a wide bandgap polymer donor in Perylene diimide (PDI)-based polymer solar cells (PSCs).

HM-JF526 NHS, a fuorogenic spontaneously blinking yellow-emitting dye, is a hydroxymethyl derivative of JF526. HM-JF526 NHS is suitable for super-resolution imaging including dSTORM, STED and single-molecule localization spectroscopy (SMLSM).

HaXS8 is a dimerizer that can promote a covalent and irreversible intracellular dimerization of HaloTag and SNAP-tagged proteins of interest. HaXS8 does not interfere with PI3K/mTOR signaling.

TP-472N is a negative control probe for TP-472. TP-472 is a potent and selective BRD7/9 probe.

Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide TFA has the potential for osteosarcoma research.

GPR35 agonist 2 (compound 11) is a potent agonist of GPR35, with EC50s of 26 and 3.2 nM in the β-arrestin and Ca2+ release assay, respectively.

N-benzoyl-L-aspartic acid, a major metabolite of benzyl glucosinolate, can be used for modification of peptides or proteins.

Nur77 modulator 1 is a good Nur77 binder (KD = 3.58 μM). Nur77 modulator 1 up-regulates Nur77 expression, mediates sub-cellular localization of Nur77, induces Nur77-dependent ER stress and autophagy, and results in cell apoptosis. Anti-hepatoma activity.

SCH 32615 is an enkephalinase (the enzymes responsible for the degradation of endogenous enkephalins) inhibitor. SCH 32615 can enhance surgery- and pregnancy-induced analgesia in mice.

MEISi-2 is a selective inhibitor of MEIS, a key regulator of hematopoietic stem cell (HSC) self-renewal. MEISi-2 is developed for the research of cardiac injuries, hematopoiesis issues, bone marrow transplantations, and cancer.

Sephadex LH 20 could be used for the isolation of natural compounds and food, such as red wine and pigments.