Neratinib, also known as HKI-272 or PB272, is an orally available, irreversible inhibitor of the HER-2 receptor tyrosine kinase with potential antineoplastic activity. Neratinib binds to the HER-2 receptor irreversibly, thereby reducing autophosphorylation in cells, apparently by targeting a cysteine residue in the ATP-binding pocket of the receptor.

Thiodipropionic acid is an organic disulfide used as a ligand for the synthesis of cadminum and zinc coordination polymers that have luminescent properties.

Exifone is a bioactive chemical.

para-Cresol, also 4-methylphenol, is an organic compound with the formula CH?C?H?. It is a colourless solid that is widely used intermediate in the production of other chemicals.

Cabazitaxel-d6 is a deuterium labeled cabazitaxel. Cabazitaxel is a semi-synthetic derivative of the natural taxoid 10-deacetylbaccatin III with potential antineoplastic activity. Cabazitaxel binds to and stabilizes tubulin, resulting in the inhibition of microtubule depolymerization and cell division, cell cycle arrest in the G2/M phase, and the inhibition of tumor cell proliferation. Unlike other taxane compounds, this agent is a poor substrate for the membrane-associated, multidrug resistance (MDR), P-glycoprotein (P-gp) efflux pump and may be useful for treating multidrug-resistant tumors. In addition, cabazitaxel penetrates the blood-brain barrier (BBB).

Phosphatidylcholines (PC) are a class of phospholipids that incorporate choline as a headgroup. They are a major component of biological membranes and can be easily obtained from a variety of readily available sources, such as egg yolk or soybeans, from which they are mechanically or chemically extracted using hexane. They are also a member of the lecithin group of yellow-brownish fatty substances occurring in animal and plant tissues. Dipalmitoyl phosphatidylcholine (aka: lecithin) is a major component of pulmonary surfactant and is often used in the L/S ratio to calculate fetal lung maturity. While phosphatidylcholines are found in all plant and animal cells, they are absent in the membranes of most bacteria, including Escherichia coli. Purified phosphatidylcholine is produced commercially.

Yubeinine is an alkaloid, isolated from the bulbs of Fritillaria yuminensis.

(R)-Gyramide A hydrochloride is a bacterial DNA gyrase inhibitor that disrupts supercoiling activity with an IC50 value of 3.3 μM. (R)-Gyramide A hydrochloride demonstrates antibacterial activity against E. coli, P. aeruginosa, and S. enterica (MICs of 10-80 μM). (R)-Gyramide A hydrochloride does not affect the closely related enzyme topoisomerase IV.

N1,N12-Diacetylspermine dihydrochloride is a diacetylated derivative of spermine. Upregulation of N1,N12-Diacetylspermine dihydrochloride has been linked to the incidence of cancer, making it to be a potential biomarker for cancer detection.

Methyl 2,3-O-Isopropylidene-β-D-ribofuranoside, obtained from D-ribose, is an intermediate for the synthesis of riboside-containing arsenic compound.

Methyl 2,3-O-Isopropylidene-β-L-ribofuranoside is an enantiomer of Methyl 2,3-O-Isopropylidene-β-D-ribofuranoside. Methyl 2,3-O-Isopropylidene-β-L-ribofuranoside is a derivative of L-ribose.

Pronase E (Activity≥4000 U/mg) is a mixture of proteolytic enzymes that is obtained from Streptomyces griseus and could digest protein into individual amino acids.

(S)-ZINC-3573 is a negative control for (R)-ZINC 3573. (S)-ZINC-3573 displays no activity at MRGPRX2 at concentrations below 100 μM.

2-Undecanol (Undecan-2-ol) is a male specific volatile identified from the sap beetle Lobiopa insularis. 2-undecanol is a flower emitted volatile, used by various species of Hymenoptera as a pheromone component.

3-Keto petromyzonol, a main component of Sea lamprey male sex pheromones, modulates both synthesis and release of gonadotropin releasing hormone (GnRH), and subsequently, hypothalamic-pituitary-gonadal (HPG) output in immature sea lamprey.

Homobaldrinal is a decomposition product of Valepotriate. Homobaldrinal exhibits genotoxic activity in the Salmonella/microsome test.

Yibeissine is a steroidal alkaloid isolated from the bulb of Fritillaria pallioiflora Schren.

Lupeol acetate, a derivative of Lupeol, suppresses the progression of rheumatoid arthritis (RA) by inhibiting the activation of macrophages and osteoclastogenesis through downregulations of TNF-α, IL-1β, MCP-1, COX-2, VEGF and granzyme B.

Microcolin B is an extremely potent unusual acylpeptide, proline-containing potent immunosuppressant. Microcolin B is isolated from blue-green alga Lyngbya majuscule.

β-Aspartylaspartic acid is a natural compound found in Asparagus (Asparagus officinalis) Shoots.

Dihydrojasmonic acid is a plant growth regulator.

N-(3-Oxotetradecanoyl)-DL-homoserine lactone, a member of N-Acyl homoserine lactone (AHL) from gram-negative bacteria, is a quorum sensing (QS) signaling molecule.

2'-Aminoacetophenone is an aromatic compound containing a ketone substituted by one alkyl group, and a phenyl group. 2'-Aminoacetophenone can be used as a breath biomarker for the detection of Ps. Aeruginosa infections in the cystic fibrosis lung.

(Z)-Akuammidine ((Z)-Rhazine) is isolated from Gelsemium elegans.

Manool is a diterpene from Salvia officinalis. Manool induces selective cytotoxicity in cancer cells. Manool arrests the cancer cells at the G(2)/M phase of the cell cycle.

Scopoletin acetate is a coumarin isolated from Artemisia granatensis.

29-Nor-20-oxolupeol, extracted from Impatiens basamina, reduces NO levels in LPS-activated murine microglial cells with an IC50 of 44.21 μM.

α-Amyrin palmitate is isolated from Santalum album (sandalwood).?α-Amyrin palmitate can be used for the study of arthritis in vivo.

Megastigm-7-ene-3,5,6,9-tetraol (Megastigma-7-en-3,5,6,9-tetraol) is a diterpenoid analogue in the aerial parts of Isodon melissoides. Megastigm-7-ene-3,5,6,9-tetraol is also in Vigna luteola and has anti-inflammatory bioactivity.

Euojaponine D is a sesquiterpene alkaloids from Euonymus japonica (Celastraceae). Celastraceae has potent insecticidal activity.

Didrovaltrate (Didrovaltratum), isolated from the roots of Valeriana wallichii D.C, is a cytotoxic and antitumor agent.

Monensin B is a polyketide produced by Streptomyces cinnamonensis. Fermentations of Streptomyces cinnamonensis produce a mixture of Monensin A and Monensin B in a ratio dependent upon the relative concentrations of ethylmalonyl-CoA and methylmalonyl-CoA.

Rubropunctamine is a red azaphilone pigment isolated from the extracts of Monascus pilosus-fermented rice (red-mold rice). Rubropunctamine has anti-inflammation activities.

Bombykol, the first insect sex pheromone, is identified as the female-produced sex attractant of the silkworm moth Bombyx mori.

Gomisin E, a dibenzocyclooctadiene lignan isolated from the fruits of Schizandra chinensis, inhibits NFAT transcription with an IC50 of 4.73 μM.

Massoia lactone ((±)-Massoia lactone) is a coconut and creamy fragrant compound mianly isolated from Cryptocarya massoy. Massoia lactone is also a fragrant biosurfactant produced by a fungus Aureobasidium pullulans.

Methyl propyl disulfide is an volatile sulfur-containing compound produced in garlic and onions with anticaner effect.

Anhydroerythromycin A is a degradation product of the macrolide antibiotic erythromycin. Anhydroerythromycin A is formed via degradation of erythromycin in acidic aqueous solutions in vitro as well as in vivo. Anhydroerythromycin A is active against S. aureus and B. cereus in vitro (MICs = 12.5 and 6.25 μg/ml, respectively). Anhydroerythromycin A also inhibits steroid 6β-hydroxylase activity associated with the cytochrome P450 (CYP) isoform CYP3A in human liver microsomes.

Pentacosane is one of the major components in the acetone extract from Curcuma raktakanda and is also in the essential oil from the leaves of Malus domestica. Pentacosane exhibit anti-cancer activities.

2-(Hydroxymethyl)anthraquinone is used as a photoremovable protecting group (PRPG) to chemically cage sex pheromone (e.g. (Z)-11-hexadecen-1-ol (sex pheromone of?Chilo infuscatellussnellen)).

Cognac oil, mainly found in wine lees, has unique fatty acid profiles, including Palmitic acid (59.26%), Linoleic acid (11.92%), Myristic acid (8.97%), Oleic acid (8.3%) and other fatty acids. Cognac oil leads to a general increase in the permeation of R6G (Rhodamine 6G) across all the membranes.

Safranal is an orally active main component of Saffron (Crocus sativus) and is responsible for the unique aroma of this spice. Safranal has neuroprotective and anti-inflammatory effects and has the potential for Parkinson’s disease research.

Acetylatractylodinol, isolated from Atractylodes lancea, possesses antioxidant activity.

Ursonic acid methyl ester is an esterified derivative of Ursolic acid. Ursonic acid methyl ester shows growth inhibitory activity against four tumor cell lines, HL-60, BGC, Bel-7402 and Hela with ED50 values of >100 μg/ml.

Dihydrolapachenole is a naturally occurring quinone.

Desoxylimonin is a triterpenoid compound isolated from grapefruit seed. Desoxylimonin derivatives has better anticancer, analgesic and anti-inflammatory activitythan the lead compound.

Dihydroseselin is a 7-hydroxycoumarin derivative. 7-hydroxycoumarin is a natural product of the coumarin family, is a fluorescing compound which can be used as a sunscreen agent

Neoanhydropodophyllol is a cyclolignan derivative, with antineoplastic activity. Neoanhydropodophyllol displays cytotoxicity against several cancer cells (leukemia, lung carcinoma, colon carcinoma).

Taccalonolides C, isolated from T. plantaginea, is an anti-cancer agent.

Saikogenin F is isolated from the chloroform extract of the Chinese medicine formula Shenqi San. Anti-cancer activity.

Euphorbetin, isolated from the ethyl acetate extract of the dried whole plants of Viola yedoensis Makino, exhibits anticoagulant activities.

Podophyllol, a derivative of podophyllotoxin esters, has antitumor activity.

Isotoosendanin is a limonoid isolated from Melia toosendan fruit. Isotoosendanin displays significant anti-inflammatory and analgesic activities.

Debenzoylpaeoniflorgenin is a natural compound from Paeonial lactiflora in Guizhitang.

Pennogenin is a bioactive component which can be isolated from T. govanianum rhizomes. Pennogenin exhibits significant in vitro inhibitory effect on release of ROS.

Methyl behenate (Methyl docosanoate) is a naturally fatty acid methyl ester isolated from the plant of Aspidopterys obcordata Lemsl.

Diethyl fumarate is a decomposition product of Malathion (an insecticide). Diethyl fumarate is a reputed skin irritant. Diethyl fumarate can causes non-immunologic contact urticaria on skin.

β-Cyclocitral, a volatile oxidized derivative of β-carotene, is a grazer defence signal unique to the Cyanobacterium Microcystis. β-Cyclocitral, one of the predominant volatile terpenoid compounds, can upregulate the expression of defence genes to enhance excess light (EL) acclimation. β-Cyclocitral is a powerful repellent.

cis-3-Hexen-1-ol ((Z)-3-Hexen-1-ol) is a green grassy smelling compound found in many fresh fruits and vegetables. cis-3-Hexen-1-ol is widely used as an added flavor in processed food to provide a fresh green quality. cis-3-Hexen-1-ol is an attractant to various insects.

Methyl palmitoleate ((Z)-Methyl hexadec-9-enoate), a fatty acid methyl ester, is an analogue of Palmitoleate with cytoprotective and growth-promoting properties.

Isoquinoline is an analog of?pyridine. Isoquinoline structural-based alkaloids, such as tropoloisoquinoline, phthalideisoquinoline, and naphthylisoquinoline has anti-cancer activities.

Gondoic acid (cis-11-Eicosenoic acid), a monounsaturated long-chain fatty acid, is contained in a variety of plant oils and nuts.

1-Phenylpropane-1,2-dione, isolated from young Ephedra sinica Stapf (Ephedraceae), is biosynthetic precursors of the ephedrine alkaloids.

1,3-Oxazolidine-2-thione, a free oxazolidinethione, increases thyroid size and severely depresses hepatic trimethylamine oxidase activity in the laying diet domestic fowl.

YM-244769 dihydrochloride is a potent Na+/Ca2+ exchange (NCX) inhibitor that preferentially inhibits NCX3 (IC50=18 nM). Neuronal and renal protection.

Cyclic nona-L-arginine TFA, a nonaarginine peptide used for drug delivery, translocates faster than their linear counterparts.

Cyclic nona-L-arginine hydrochloride, a nonaarginine peptide used for drug delivery, translocates faster than their linear counterparts.

α-L-Rhamnose is a terminal residue of steviol glycosides Dulcoside A and Dulcoside B. α-L-Rhamnose recognizing lectin site of human dermal fibroblasts functions as a signal transducer: modulation of Ca2+ fluxes and gene expression.

Methylophiopogonone B, a homoisoflavonoidal compound that could be isolated from Ophiopogonis Tiber, could scavenge •OH and H2O2 in vitro to a certain extent.

Resibufagin is a kind of bufadienolide isolated from the venom of Bufo bufo gargarizans, has anti-tumor activities.

Vaccarin E is a natural C-glycosylflavone that could be isolated from V. hispanica.

Ophiopogonside A, a natural conpound that could be isolated from ophiopogon japonicas, possesses anti-cancer activity.

3,3'-Di-O-methylellagic acid-4'-O-β-D-glucopyranoside is a ellagic acid derivative that can be isolated from Dipentodon sinicus.

Hyponine D is an immunosuppressive sesquiterpene alkaloid that could be isolated from Tripterygium wilfordii.

Ergosterol peroxide is a steroid derivative and can be isolated from a variety of fungi, yeast, lichens or sponges. Ergosterol peroxide has anti-tumour, proapoptotic, anti-inflammatory, anti-mycobacterial, and anti-proliferative activities.

Glucodigifucoside, a cardenolide glycoside that could be isolated from the seeds of Digitalis purpurea, exhibits potent cytotoxicity against human renal adenocarcinoma cell line ACHN.

Anhydrovinblastine is a monoterpenoid indole alkaloid that can be isolated from Catharanthus roseus leaves.

Hyponine E, a macrocyclic sesquiterpene pyridine alkaloid that could be isolated from from Tripterygium hypoglaucum, possesses anti-inflammatory effects.

Pinobanksin 3-acetate is a one of Pinobanksin ester derivatives that can be isolated from Sonoran propolis.

6α-Chloro-5β-hydroxywithaferin A is a withanolide that can be isolated from W. somnifera. W. somnifera has antioxidant, anti-inflammatory, immunomodulatory, anticarcinogenic, antibacterial antiparkinsonism and antistress properties.

Siegesmethyletheric acid is isolated from the ethyl acetate fraction of Siegesbeckia orientalis L. (Asteraceae).

(2′S)-4′-O-β-D-apiofuranosyl-(1→6)-O-β-D-glucopyranosylvisamminol is a chromone Glycoside that could be isolated from Roots of Saposhnikovia divaricate. (2′S)-4′-O-β-D-apiofuranosyl-(1→6)-O-β-D-glucopyranosylvisamminol exhibits weak anti-cancer activity in human cancer cell lines.

(2R)-3α,7,4'-Trihydroxy-5-methoxy-8-prenylflavanone is isolated from the roots of Sophora flavescens.

2-Methylpyrazine is a kind of alkylpyrazine that can be identified in roasted red pepper seed oils.

2-Methylcyclopentane-1,3-dione is a key intermediate for the total synthesis of steroids.

(Rac)-Arnebin 1 ((Rac)-β,β-Dimethylacrylalkannin) is the racemate of β,β-Dimethylacrylalkannin and/or β,β-Dimethylacrylshikonin. β,β-Dimethylacrylalkannin and β,β-Dimethylacrylshikonin are napthoquinones isolated from Arnebia nobilis. β,β-Dimethylacrylshikonin has anti-tumor activity.

Anemarrhenasaponin III is a steroidal saponin isolated from the rhizome of Anemarrhena asphodeloides Bunge (Liliaceae).

(E)-Ferulic acid methyl ester (Methyl (E)-ferulate) exhibits strong DPPH and ABTS+ radical scavenging activities.

α-Farnesene is classified as a sesquiterpene, and is a herbivore-induced plant volatile (HIPV). α-Farnesene has an important effect on insect resistance in many plant species.

8-Hydroxy-7-methoxycoumarin is a phenylpropanoid isolated from the calyxes of Physalis alkekengi L. var. franchetii (Mast.) Makino.

Angeloyl-(+)-gomisin K3 is a dibenzocyclooctane lignan.

Homodihydrocapsaicin I is a kind of capsaicinoid isolated from the fruits of Capsicum annuum.

Isoscoparin is a flavonoid that could be isolated from EtOAc extract of Gentiana algida Pall. Isoscoparin possesses antioxidant activity.

Isorhamnetin-3-O-sophoroside-7-O-rhamnoside, the major flavonol glycoside, is isolated from sea buckthorn (Hippophaë rhamnoides). Isorhamnetin-3-O-sophoroside-7-O-rhamnoside has the algicidal activity against the growth of the harmful microalgae.

Matairesinol 4′-O-β-D-glucopyranoside displays cytotoxic activity against HeLa cell line with an IC50 of 47.1 μM.

5-O-(3'-O-Glucosylcaffeoyl)quinic acid (compound 19) is a phenolic compound found in the leaves of Ilex glabra L. Gray (Aquifoliaceae).

Gaultherin, a natural salicylate derivative, is isolated from Gaultheria yunnanensis. Gaultherin is a non-steroidal anti-inflammatory drug (NSAID). Gaultherin has analgesic and anti-inflammatory effects and lack gastric ulcerogenic effect compared to Aspirin.

Chamigrenal is a natural product that can be extract from the fruits of Schisandra sphenanthera.

(-)-Sesamin isolated from Asarum forbesii Maxim, is an isomer of Sesamin. Sesamin is a potent and selective delta 5 desaturase inhibitor in polyunsaturated fatty acid biosynthesis.

JF525, SE, a yellow fluorescent dye, is an excellent label for histone H2B-HaloTag fusions in live cells (Ex = 525 nm; Em = 549 nm).

Batatasin I is a natural product that can be isolated from tuberous roots of Dioscorea batatas, with antifungal activity and anti-inflammatory effects.

25S-Inokosterone is a phytoecdysone in the roots of two same species of A. bidentata Blume and A. japonica Nakai, and two different species of C. capitata Moq and C. officinalis Kuan. 25S-Inokosterone has the potential for the LPS-induced acute kidney injury research.

Daurinoline is an alkaloid that can be isolated from the roots of Menispermum dauricum. Daurinoline may be a potential anti-tumor agent or chemosensitizer for chemo-resistant NSCLC research.

N-Vanillyldecanamide, a capsaicinoid isolated from the fruits of Capsicum annuum, significantly reduced the radical length of Lactuca sativa seedling in a dose-dependent manner.

Kauran-18-oic acid, 16,17,19-trihydroxy-, (4α)- (compound 5) is a endogenous ent-kaurane diterpene compound in green coffee beans, providing direct chemical indicators of low-quality coffee.

STOCK2S-26016 is a WNK signalling inhibitors. STOCK2S-26016 inhibits WNK4 and WNK1 with IC50s of 16 μM and 34.4 μM, respectively. STOCK2S-26016 has potential for antihypertensive research.

Mifamurtide sodium (MTP-PE sodium), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide sodium, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide sodium has the potential for osteosarcoma research.

X5050 is a REST inhibitor, with an EC50 of 2.1 μM.

(±)-Acetylcarnitine chloride (Acetyl dl-carnitine chloride) is a weak cholinergic agonist with cholinergic properties. (±)-Acetylcarnitine chloride is an important intermediate in lipid metabolism.

Acifluorfen, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen causes strong photooxidative destruction of pigments and lipids in sensitive plant species.

Photosensitizer-1 is a photosensitizer.

N6-Benzoyl-5′-O-(4,4′-dimethoxytrityl)-2′-deoxyadenosine can be used as an intermediate.

5'-O-DMT-Bz-rA is an intermediate for cyclic di-nucleotide compounds synthesis.

D-Panose is a PAN-type oligosaccharide. D-Panose is a food ingredient based on isomaltooligosaccharides (IMOs).

dUTP trisodium is used for PCR.

H-Tyr-Ala-OH (Tyrosylalanine) is a L-tyrosine- and L-alanine-containing dipeptide.

Violuric acid is a redox mediator used in the laccase system. The violuric acid assay is a method to ascertain that the high-redox potential of laccase is not lost during directed evolution.

2,4-Difluororesorcinol is a fluorinated building block.

Dmt-2'-f-dc(ac) amidite (2'-F-Ac-dC Phosphoramidite) is a phosphoramidite which can be used in the preparation of cyclic purine dinucleotides.

dUTP sodium is used for PCR.

L-Histidine benzyl ester bistosylate could play a role in the activation of HutP (an RNA-binding protein).

RapiFluor-MS labeling used for LC-MS/MS analysis of N-glycans.

3-Acetamidocoumarin plays an important role in biology and medicine. 3-Acetamidocoumarin has physiological effects and has been used for many diseases such as treatment of burns, brucellosis-rheumatic diseases and cancer.

5'-O-DMT-2'-O-iBu-N-Bz-Guanosine could be used for silyl protection of ribonucleosides.

2′-O-(2-Methoxyethyl)adenosine is a compound can be used in the synthesis of oligonucleotides.

2-Bromo-6-nitrophenol is converted via 2-bromo-6-aminophenol to N-acetyl-2-bromo-6-aminophenol.

2-Methylanisole is a monomethoxybenzene and acts as an intermediate for the preparation of compounds with methylhydroquinone core .

2'-O-(2-Methoxyethyl)-cytidine is a synthetic oligonucleotide conversed from uridine. 2'-O-(2-Methoxyethyl)-uridine has the potential for chemotherapeutic agents development.

2'-O-(2-Methoxyethyl)-uridine is a synthetic oligonucleotide conversed from uridine. 2'-O-(2-Methoxyethyl)-uridine has the potential for chemotherapeutic agents development.

3-Diethylamino-1-propanol is an tertiary amine compound with anticonvulsant activity.

5'-O-DMT-ibu-rG is a useful model for a new class of DNA binding molecules for the development of potent and selective anti-cancer agents.

5'-O-DMT-N2-ibu-dG (N2-Isobutyryl-5′-O-(4,4′-dimethoxytrityl)-2′-deoxyguanosine) is a deoxynucleoside which can be used in the preparation of oligonucleotides.

Calcium lactate is used by the beverage industry as a source of calcium to fortify fruit juice. Calcium lactate facilitates the growth and phytic acid degradation of soybean sprouts.

Cyclocreatine is a Creatine analogue and acts as a potent bioenergetic protective agent by providing high levels of ATP. Cyclocreatine crosses membranes, enters the brain, and can be phosphorylated and dephosphorylated by creatine kinases.

DMT-dI (5'-O-DMT-dI) is a deoxyuridine which can be used in the preparation of convertible nucleoside derivatives.

L-Lactic acid-13C3 is a stable isotope labeled L-Lactic acid analog. L-Lactic acid-13C3 can be used for lactate metabolism research.

N-(3-Aminopropyl)cyclohexylamine, a cyclohexylamine derivative, acts as a selective and competitive inhibitor of spermidine synthase. N-(3-Aminopropyl)cyclohexylamine can be used for the research of neurological diseases.

Bz-rC Phosphoramidite is a phosphinamide monomer that can be used in the preparation of oligonucleotides.

Cimifugin 4'-O-β-D-glucopyranoside is a derivative of cimifugin.

2'-OMe-Ac-C Phosphoramidite is a modified phosphoramidite and can be used for the oligonucleotide synthesis.

DMT-2′Fluoro-dU Phosphoramidite could be used for nucleoside modification.

24:0 Lyso PC is a lysophospholipid (LyP). 24:0 Lyso PC could be used for mRNA drug delivery.

N-​(3-​Methoxybenzyl-​(9z,​12z)​-​octadecadienamide (Macamide impurity 10), the impurity of Macamide isolated from Lepidium meyenii.

Poly(2-hydroxyethyl methacrylate) (MW 1000000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.

Poly(2-hydroxyethyl methacrylate) (MW 20000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.

JF635, SE (JF635, NHS) is a red fluorogenic fluorescent dye containing an NHS ester that can be conjugated with primary amine groups. JF635, SE can be used in confocal fluorescent imaging, super-resolution microscopy, and live cell imaging.

Sephadex LH 20 could be used for the isolation of natural compounds and food, such as red wine and pigments.

MEISi-2 is a selective inhibitor of MEIS, a key regulator of hematopoietic stem cell (HSC) self-renewal. MEISi-2 is developed for the research of cardiac injuries, hematopoiesis issues, bone marrow transplantations, and cancer.

SCH 32615 is an enkephalinase (the enzymes responsible for the degradation of endogenous enkephalins) inhibitor. SCH 32615 can enhance surgery- and pregnancy-induced analgesia in mice.

Nur77 modulator 1 is a good Nur77 binder (KD = 3.58 μM). Nur77 modulator 1 up-regulates Nur77 expression, mediates sub-cellular localization of Nur77, induces Nur77-dependent ER stress and autophagy, and results in cell apoptosis. Anti-hepatoma activity.

N-benzoyl-L-aspartic acid, a major metabolite of benzyl glucosinolate, can be used for modification of peptides or proteins.

GPR35 agonist 2 (compound 11) is a potent agonist of GPR35, with EC50s of 26 and 3.2 nM in the β-arrestin and Ca2+ release assay, respectively.

Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide TFA has the potential for osteosarcoma research.

TP-472N is a negative control probe for TP-472. TP-472 is a potent and selective BRD7/9 probe.

HaXS8 is a dimerizer that can promote a covalent and irreversible intracellular dimerization of HaloTag and SNAP-tagged proteins of interest. HaXS8 does not interfere with PI3K/mTOR signaling.

HM-JF526 NHS, a fuorogenic spontaneously blinking yellow-emitting dye, is a hydroxymethyl derivative of JF526. HM-JF526 NHS is suitable for super-resolution imaging including dSTORM, STED and single-molecule localization spectroscopy (SMLSM).

PBDB-T is a wide bandgap polymer donor in Perylene diimide (PDI)-based polymer solar cells (PSCs).

DL-Penicillamine (DL-beta-Mercaptovaline, 3,3-Dimethyl-DL-cysteine, 3-Sulfanylvaline, Cuprimine, Depen, DL-PenA, DL-P) induces alteration of elastic fibers of periosteum-perichondrium and associates growth inhibition.

NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.

Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay.

AGA-(C8R) HNG17, Humanin derivative is a potent humanin (HN) derivative. AGA-(C8R) HNG17, Humanin derivative completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.

HIF-1 alpha (556-574) is a short hypoxia-inducible factor-1 (HIF-1) 19 residues fragment. HIF-1 functions as master regulator of response to oxygen homeostasis.

JAG-1, scrambled is a scrambled sequence of JAG-1. JAG-1, scrambled with a random sequence of the amino acids that are the same as the active fragment. JAG-1, scrambled usually used as a negative control.

NY-BR-1 p904 (A2) is an HLA-A2-restricted NY-BR-1 epitope. T-cell clone specific for NY-BR-1 p904 can recognize breast tumor cells expressing NY-BR-1.

TLQP-30 is a VGF peptide.

Chemerin-9 (149-157), the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR.

Suc-Ile-Glu(γ-pip)-Gly-Arg-pNA hydrochloride is a factor Xa specific chromogenic substrate.

BDC2.5 mimotope 1040-31, a BDC2.5 TCR reactive peptide, is a strong agonistic peptide for diabetogenic T cell clone BDC2.5, and the 1040-31 peptide is specific for BDC 2.5 TCR Tg+ T cells.

TCTDSTNCYKAT is an engineered-variant peptide of antifreeze protein (AFP).

Bim BH3, Peptide IV is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins.

Hsp70-derived octapeptide is a conserved octapeptide of the C-terminal end of Hsp70, which physically interacts with tetratricopeptide repeat (TPR) motifs.

TCS 184 is a polypeptide fragment.

MCA-SEVNLDAEFR-K(Dnp)-RR, amide is a FRET-based substrate.

11R-VIVIT is a potent NFAT inhibitor. 11R-VIVIT inhibits LPS or LPS plus IFN-γ-induced IL-12 p40, IL-12 p70, IL-23 and TNF secretion from bone marrow-derived macrophages (BMDMs). 11R-VIVIT also attenuates NO production and Nos2 mRNA expression in LPS-stimulated BMDMs. 11R-VIVIT improves symptoms in a mouse model of colitis. Exhibits immunosuppressive effects; enhances graft survival in mice.

Obestatin(human) is an endogenous peptide derived from the same prepropeptide as ghrelin. Obestatin(human) suppresses food intake and reduce body weight-gain in rats.

VPM peptide TFA is a dithiol protease-cleavable peptide cross-linker. VPM peptide TFA can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel.

T7 Tag Peptide TFA is a protein tag derived from the N-terminal 11 residues of the major T7 capsid protein, gp 10. T7 Tag Peptide TFA can be used in different immunoassays as well as affinity purification.

OVA (241-270) TFA, a non-specific cytotoxic T lymphocyte (CTL) peptide, is a fragmented peptide of OVA (ovalbumin) antigen.

TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.

VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel.

Ac2-12, an annexin/lipocortin 1 (LC1)-mimetic peptide, inhibit neutrophil extravasation. Ac2-12 has antimigratory action and inhibits recruitment of neutrophils in experimental inflammation models.

Ac-IEPD-AFC is a substrate of Granzyme B.

9,10-Dihydroxystearic acid is an oxidation product of oleic acid. 9,10-Dihydroxystearic acid can improve glucose tolerance and insulin sensitivity in KKAy mice.

Acenaphthylene is a polycyclic aromatic hydrocarbon (PAH). PAHs are derived naturally from coal and tar deposits, and produced by incomplete combustion of organic matter.

Benzothiazole is a natural occurring heterocyclic nuclei. Benzothiazole nucleus possesses a number of biological activities such as anticancer, antimicrobial, antidiabetic, anti-inflammatory, antiviral, antileishmanial, and antiviral.

Hygric acid (N-Methyl-L-proline) is a proline analogue found in the citrus juices and the juice of bergamot.

p-Fluoro-L-phenylalanine (4-Fluoro-L-phenylalanine) is a substrate for tyrosine hydroxylase (TH) that can be used to study the regulation of that enzyme. p-Fluoro-L-phenylalanine binds to the L-leucine specific receptor of Escherichia coli (KD=0.26 μM).

trans-1,2-Cyclohexanediaminetetraacetic acid is a commonly used aminopolycarboxylic acid and a strong chelator of heavy metal ions.

(-)-Heraclenol is a derivative of furocoumarin isolated from Ducrosia anethifolia. (-)-Heraclenol shows antiproliferative and cytotoxic activities on cancer cell lines.

3-(β-D-Glucopyranosyloxy)-1,6-dihydroxy-2-methyl-9,10-anthracenedione is a anthraquinone isolated from Rubia cordifolia.

5-Hydroxy-8-methoxypsoralen (5-Hydroxyxanthotoxin) is a metabolite of Xanthotoxin. Xanthotoxin is a potent tricyclic furocoumarin suicide inhibitor of CYP (cytochrome P-450), is an agent used to treat psoriasis, eczema, vitiligo and some cutaneous Lymphomas in conjunction with exposing the skin to sunlight.

Cathayanon H is isolated from the paper mulberry tree. Cathayanon H is cytotoxic against human ovariancarcinoma cells.

Diacetoxy-6-gingerdiol is a diarylheptanoid isolated from the dichloromethane extract of rhizomes of ginger (Zingiber officinale Roscoe).

JF549 TFA is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

JF549,SE (JF549,NHS) is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

β-Gentiobiose (Gentiobiose) is a naturally occurring oligosaccharin with a rapid turnover rate in ripening tomato fruit.

(+)-Isolariciresinol ((+)-Cyclolariciresinol) can be used for the research of rheumatitis. Anti-inflammatory activity.

Eicosyl ferulate, a phenolic compound, is isolated from the fresh root and stem of Aristolochia kankauensis. Eicosyl ferulate exhibits glucose uptake stimulatory activity.