Cat. No. | Product name | CAS No. |
DC9152 |
Benazepril Hydrochloride
Benazepril hydrochloride, an angiotensin converting enzyme inhibitor, which is a medication used to treat high blood pressure. |
86541-74-4 |
DC8975 |
Captopril
Captopril is a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). |
62571-86-2 |
DC9325 |
Cilazapril (monohydrate)
Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure. |
92077-78-6 |
DC12262 |
H-Val-Pro-Pro-OH TFA
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC50 of 9 μM. |
|
DC9123 |
Lisinopril Dihydrate
Lisinopril Dihydrate is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks. |
83915-83-7 |
DC12255 |
MLN-4760
Featured
MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM). |
305335-31-3 |
DC9326 |
Moexipril (hydrochloride)
Moexipril HCl is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure. |
82586-52-5 |
DC10324 |
Omapatrilat
Omapatrilat is a dual inhibitor of the metalloproteases ACE and NEP with Ki values of 0.64 and 0.45 nM, respectively. |
167305-00-2 |
DC9128 |
Ramipril
Ramipril is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM. |
87333-19-5 |
DC9327 |
Temocapril (hydrochloride)
Temocapril Hydrochloride is a long-acting angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension. |
110221-44-8 |
DC9328 |
Zofenopril (calcium)
Zofenopril Calcium(SQ26991) is an antioxidant that acts as an angiotensin-converting enzyme inhibitor. |
81938-43-4 |
DC28192 |
Delapril hydrochloride
Delapril is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases. |
83435-67-0 |
DC28193 |
Deserpidine
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex. |
131-01-1 |
DC29151 |
DX600 TFA
DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE. |
|
DC40003 |
BML-111
BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties. |
78606-80-1 |
DC40211 |
H-Ile-Pro-Pro-OH hydrochloride
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides. |
1208862-61-6 |
DC41405 |
Icariside D2
Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis . |
38954-02-8 |
DC42333 |
Vicenin-1
Vicenin 1 is a C-glycosylflavone isolated from the aerial parts of Desmodium styracifolium, has any effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM). |
35927-38-9 |
DC42520 |
Spirapril hydrochloride
Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure. |
94841-17-5 |
DC44802 |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions. |
|
DC45309 |
(R)-MLN-4760
(R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM). |
305335-29-9 |
DC45903 |
Camellianin B
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities. |
109232-76-0 |