| DC9152 |
Benazepril Hydrochloride |
Benazepril hydrochloride, an angiotensin converting enzyme inhibitor, which is a medication used to treat high blood pressure. |
|
| DC8975 |
Captopril |
Captopril is a potent, competitive inhibitor of angiotensin-converting enzyme (ACE). |
|
| DC9325 |
Cilazapril (monohydrate)
Featured
|
Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
|
|
| DC12262 |
H-Val-Pro-Pro-OH TFA
Featured
|
H-Val-Pro-Pro-OH (TFA) is a trifluoroacetate (TFA) salt form of the tripeptide H-Val-Pro-Pro-OH, which is derived from milk proteins. This peptide is known for its ability to inhibit Angiotensin I Converting Enzyme (ACE), a key enzyme in the renin-angiotensin system (RAS) that regulates blood pressure. The TFA salt form is commonly used in research and pharmaceutical applications to improve the solubility and stability of the peptide. |
|
| DC9123 |
Lisinopril Dihydrate |
Lisinopril Dihydrate is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks. |
|
| DC12255 |
MLN-4760
Featured
|
MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM). |
|
| DC9326 |
Moexipril (hydrochloride) |
Moexipril HCl is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure. |
|
| DC10324 |
Omapatrilat |
Omapatrilat is a dual inhibitor of the metalloproteases ACE and NEP with Ki values of 0.64 and 0.45 nM, respectively. |
|
| DC9128 |
Ramipril |
Ramipril is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM. |
|
| DC9327 |
Temocapril (hydrochloride) |
Temocapril Hydrochloride is a long-acting angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension. |
|
| DC9328 |
Zofenopril (calcium) |
Zofenopril Calcium(SQ26991) is an antioxidant that acts as an angiotensin-converting enzyme inhibitor.
|
|
| DC28192 |
Delapril hydrochloride |
Delapril is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases. |
|
| DC28193 |
Deserpidine |
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex. |
|
| DC29151 |
DX600 TFA |
DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE. |
|
| DC40003 |
BML-111 |
BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties. |
|
| DC40211 |
H-Ile-Pro-Pro-OH hydrochloride
Featured
|
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides. |
|
| DC41405 |
Icariside D2 |
Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis . |
|
| DC42333 |
Vicenin-1 |
Vicenin 1 is a C-glycosylflavone isolated from the aerial parts of Desmodium styracifolium, has any effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM). |
|
| DC42520 |
Spirapril hydrochloride |
Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure. |
|
| DC44802 |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions. |
|
| DC45309 |
(R)-MLN-4760 |
(R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM). |
|
| DC45903 |
Camellianin B |
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities. |
|
| DC46379 |
Lyciumin A |
Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension. |
|
| DC47756 |
Plantainoside D |
Plantainoside D shows ACE inhibitory activity with IC50 2.17 mM. And plantainoside D is a promising IKK-β inhibitor. |
|
| DC48209 |
Fasidotril |
Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential treatment of hypertension and congestive heart failure (CHF). |
|
| DC48210 |
Alacepril |
Alacepril (Cetapril) is an orally active angiotensin converting enzyme (ACE) inhibitor with long lasting antihypertensive effect. |
|
| DC49724 |
AD011 |
AD011 is a dual inhibitor of cACE/NEP. AD011 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD011 has the potential for providing the potent antihypertensive and cardioprotective benefits. |
|
| DC49725 |
AD012 |
AD012 is a dual inhibitor of cACE/NEP. AD012 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD012 has the potential for providing the potent antihypertensive and cardioprotective benefits. |
|
| DC49726 |
AD013 |
AD013 is a dual inhibitor of cACE/NEP. AD013 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD013 has the potential for providing the potent antihypertensive and cardioprotective benefits. |
|
| DC71086 |
Moveltipril |
Moveltipril is a potent angiotensin converting enzyme (ACE) inhibitor. |
|
