Amyloid β-Peptide (1-37) (human)

  Cat. No.:  DC41885  
Chemical Structure
186359-67-1
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Amyloid β-Peptide (1-37) (human) is an amyloid β-protein fragment cleaved from amyloid precursor protein (APP).
Cas No.: 186359-67-1
Chemical Name: Amyloid β-Peptide (1-37) (human)
Synonyms: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Formula: C182H274N50O55S
M.Wt: 4074.53
Sotrage: Please store the product under the recommended conditions in the Certificate of Analysis.
MSDS
COA
LOT NO. DOWNLOAD
2018-0101
Cat. No. Product name Field of application
DC47758 Aβ Fibrillization modulator 1 Aβ Fibrillization modulator 1 stabilizes Aβ monomers.
DC46940 AZD4694 AZD4694, a fluorinated β-amyloid (Aβ) plaque neuroimaging PET radioligand, shows high affinity for Aβ fibrils (Kd = 2.3 nM).
DC46641 Methyl tridecanoate Methyl tridecanoate moderately inhibits β-amyloid aggregation. Methyl tridecanoate weakly inhibits acetylcholinesterase (AChE).
DC45833 Aβ/tau aggregation-IN-1 Aβ/tau aggregation-IN-1 is a potent Aβ1-42 β-sheets formation and tau aggregation inhibitor. The KD values of Aβ/tau aggregation-IN-1 with Aβ1-42 and tau are 160 μM and 337 μM, respectively. Aβ/tau aggregation-IN-1 can permeate the blood-brain barrier.
DC45771 RAGE antagonist peptide TFA RAGE antagonist peptide TFA is an advanced glycation end products (RAGE) antagonist. RAGE antagonist peptide TFA prevents RAGE from binding with several of its most important ligands, including HMGB-1, S100P, and S100A4. RAGE antagonist peptide TFA possesses anti-tumor and anti-inflammatory activities.
DC44797 Cl-NQTrp Cl-NQTrp signifcantly disrupts the preformed fbrillar aggregates of Tau-derived PHF6 (VQIVYK) peptide and full-length tau protein.
DC44796 Beta-Amyloid(1-14),mouse,rat Beta-Amyloid(1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide.
DC44795 β-Amyloid (22-40) β-Amyloid (22-40) is a peptide fragment of β-Amyloid.
DC44794 β-Amyloid (11-22) β-Amyloid (11-22) is a peptide fragment of β-Amyloid.
DC44520 Ezeprogind Ezeprogind (AZP-2006) is an orally active neurotrophic inducer. Ezeprogind targets all causes of neurodegeneration and is not only aiming at markers such as Abeta protein or tau protein. Ezeprogind is a potent neuroprotectant and can be used for the research of neurological disorders, including progressive supranuclear palsy (PSP), tauopathies, alzheimer’s and parkinson’s diseases, et al.
X