Aviptadil acetate

  Cat. No.:  DC41493  
Chemical Structure
1444827-29-5
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Aviptadil acetate is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil acetate induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al.
Cas No.: 1444827-29-5
Chemical Name: Aviptadil acetate
Synonyms: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Formula: C147H238N44O42S.C2H4O2
M.Wt: 3385.90
Sotrage: Protect from lightPowder-80°C2 years-20°C1 year*In solvent : -80°C, 6 months; -20°C, 1 month (protect from light)
MSDS
TITLE DOWNLOAD
MSDS_24506_DC41493_1444827-29-5
COA
LOT NO. DOWNLOAD
Cat. No. Product name Field of application
DC47344 SARS-CoV-2-IN-8 SARS-CoV-2-IN-8 is a SARS-CoV-2 main protease inhibitor with an IC50 value of 0.75 μM.
DC47343 XR8-69 XR8-69 is a SARS-CoV-2 PLpro inhibitor that shows low micromolar antiviral potency in SARS-CoV-2-infected human cells.
DC47342 SARS-CoV-2-IN-6 SARS-CoV-2-IN-6 is a SARS-CoV-2 3CLpro inhibitor that shows the most potent enzyme inhibitory IC50 value of 73 nM.
DC47341 Cichoriin Cichoriin is an active compounds against SARS-CoV-2, and may be a potential candidate in treating severe COVID-19.
DC47340 SARS-CoV-2-IN-7 SARS-CoV-2-IN-7 inhibits viral replication with a nanomolar IC50 value (844 nM) in SARS-CoV-2-infected Vero E6 cells.
DC47339 NK007 NK007 is a novel anti-SARS-CoV-2 agent with an EC50 value of 30 nM.
DC47338 SARS-CoV-2-IN-9 SARS-CoV-2-IN-9 is an inhibitor binding to subsites S1 and S2 in SARS-CoV-2 main protease.
DC46821 HeE1-2Tyr HeE1-2Tyr, a pyridobenzothiazole compound, is a flavivirus RNA dependent RNA polymerases (RdRp) inhibitor. HeE1-2Tyr significantly inhibits West Nile, Dengue and SARS-CoV-2 RdRps (IC50 of 27.6 µM) activity in vitro.
DC46820 Lufotrelvir Lufotrelvir (PF-07304814), a phosphate prodrug of PF-00835231, acts as a potent 3CLpro protease (Mpro) inhibitor with SARS-CoV-2 antiviral activity. Lufotrelvir binds and inhibits SARS-CoV-2 3CLpro activity with a Ki of 174nM. Lufotrelvir is promising single antiviral agent and also can be used for the research of combination with other antivirals that target other critical stages of the coronavirus life cycle.
DC46819 RdRP-IN-2 RdRP-IN-2 is a RNA dependent RNA polymerase (RdRp) inhibitor. RdRP-IN-2 significantly inhibits SARS-CoV-2 RdRp with an IC50 of 41.2 µM.RdRP-IN-2 also inhibits Feline coronavirus (FIPV) replication.
X