Defensin HNP-1 human

  Cat. No.:  DC41902  
Chemical Structure
99287-08-8
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis.
Cas No.: 99287-08-8
Chemical Name: Defensin HNP-1 human
Synonyms: ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Formula: C150H228N44O38S6
M.Wt: 3442.03
Sotrage: Please store the product under the recommended conditions in the Certificate of Analysis.
MSDS
TITLE DOWNLOAD
MSDS_24915_DC41902_99287-08-8
COA
LOT NO. DOWNLOAD
Cat. No. Product name Field of application
DC47665 4-Hydroxytryptamine creatinine sulfate 4-Hydroxytryptamine creatinine sulfate, a tryptamine derivative, is a neurotransmitter agonist.
DC47664 Indole-3-acetaldehyde Indole-3-acetaldehyde inhibits Escherichia coli O157:H7 biofilm formation.
DC47214 Phosphoribosyl pyrophosphate pentasodium Phosphoribosyl pyrophosphate (PRPP) pentasodium is an important metabolite required in the biosynthesis of purine and pyrimidine nucleotides, the amino acids histidine and tryptophan, and the cofactors NAD and NADP.
DC47141 Triiodothyronine sulfate Triiodothyronine sulfate is the main metabolite of thyroid hormone triiodothyronine (T3). Triiodothyronine is an active form of thyroid hormone, which binds to β1 thyroid hormone receptor (TRβ1), and activates its activity.
DC47116 Deutarserine Deutarserine is a deuterium modified analog of endogenous D-serine (CTP 692), which is used in the research of adults with schizophrenia.
DC47095 Larsucosterol sodium Larsucosterol sodium is a cholesterol metabolite from the nuclei of normal human liver tissues, epigenetically regulates the transcription of proteins and enzymes involved in lipid synthesis, inflammation, and apoptosis.
DC47040 Larsucosterol Larsucosterol is a cholesterol metabolite from the nuclei of normal human liver tissues, epigenetically regulates the transcription of proteins and enzymes involved in lipid synthesis, inflammation, and apoptosis.
DC47034 Ebaresdax Ebaresdax can inhibit peroxynitrite oxidation derived by SIN-1 and peroxynitrite mediated Cytotoxicity with IC50s of 3.7±0.80 and 0.13±0.02 uM, respectively.
DC47032 3-Oxo-4,6-choladien-24-oic acid 3-Oxo-4,6-choladien-24-oic acid is an endogenous metabolite. 3-Oxo-4,6-choladien-24-oic acid exsists in the urine of patients with hepatobiliary disease.
DC47031 2,8-Dihydroxyadenine 2,8-Dihydroxyadenine, an endogenous metabolite, can cause the formation of urinary crystals and kidney stones. 2,8-Dihydroxyadenine can be used to diagnose adenine phosphoribosyltransferase (APRT) deficiency.
X