Moexipril (hydrochloride)|cas 82586-52-5|DC Chemicals

Cas No.:	82586-52-5
Chemical Name:	2-(((S)-1-ethoxy-1-oxo-4-phenylbutan-2-yl)-L-alanyl)-6,7-dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride
Synonyms:	RS 10085; RS-10085; RS10085; SPM-925; SPM 925; SPM925; CI-925; CI 925; CI925; Moexipril. trade name Univasc.
SMILES:	O=C(C1N(C([C@@H](N[C@H](C(OCC)=O)CCC2=CC=CC=C2)C)=O)CC3=C(C=C(OC)C(OC)=C3)C1)O.[H]Cl
Formula:	C₂₇H₃₅ClN₂O₇
M.Wt:	535.034
Purity:	>98%
Sotrage:	2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO

Description:

Moexipril HCl is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure. Moexipril is a long-acting ACE inhibitor suitable for once-daily administration, and like some ACE inhibitors, moexipril is a prodrug and needs to be hydrolyzed in the liver into its active carboxylic metabolite, moexiprilat, to become effective. Upon oral administration of moexipril (10 mg/kg/day) to spontaneously hypertensive rats, plasma angiotensin II concentration decreased to undetectable levels, plasma ACE activity was inhibited by 98% and plasma angiotensin I concentration increased 8.6-fold 1 h after dosing. At 24 h, plasma angiotensin I and angiotensin II concentrations had returned to pretreatment levels, whereas plasma ACE activity was still inhibited by 56%. Four-week oral administration of moexipril (0.1-30 mg/kg/day) to spontaneously hypertensive rats lowered blood pressure and differentially inhibited ACE activity in plasma, lung, aorta, heart and kidney in a dose-dependent fashion.

MSDS

COA

LOT NO.	DOWNLOAD

2018-0101

Cat. No.	Product name	Field of application
DC47756	Plantainoside D	Plantainoside D shows ACE inhibitory activity with IC50 2.17 mM. And plantainoside D is a promising IKK-β inhibitor.
DC46379	Lyciumin A	Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
DC45903	Camellianin B	Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities.
DC45309	(R)-MLN-4760	(R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM).
DC44802	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
DC42520	Spirapril hydrochloride	Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure.
DC42333	Vicenin-1	Vicenin 1 is a C-glycosylflavone isolated from the aerial parts of Desmodium styracifolium, has any effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM).
DC41405	Icariside D2	Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
DC40211	H-Ile-Pro-Pro-OH hydrochloride	H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.
DC40003	BML-111	BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties.