Zofenopril (calcium)|cas 81938-43-4|DC Chemicals

Cas No.:	81938-43-4
Chemical Name:	calcium (2S,4S)-1-((S)-3-(benzoylthio)-2-methylpropanoyl)-4-(phenylthio)pyrrolidine-2-carboxylate
Synonyms:	Zofenopril calcium; SQ-26991; SQ26991; SQ 26991; Zoprace;
SMILES:	O=C(N(C[C@@H](SC1=CC=CC=C1)C2)[C@@H]2C([O-])=O)[C@H](C)CSC(C3=CC=CC=C3)=O.[0.5Ca]
Formula:	C₄₄H₄₄CaN₂O₈S₄
M.Wt:	897.16
Purity:	>98%
Sotrage:	2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO

Description:

Zofenopril Calcium(SQ26991) is an antioxidant that acts as an angiotensin-converting enzyme inhibitor. Zofenopril is a pro-drug designed to undergo metabolic hydrolysis yielding the active free sulfhydryl compound zofenoprilat, which is an angiotensin converting enzyme (ACE) inhibitor. Zofenopril promotes the regeneration of peripheral nerve injuries in rat models. Zofenopril increases SR calcium cycling and stimulates active calcium uptake into the SR.

MSDS

COA

LOT NO.	DOWNLOAD

2018-0101

Cat. No.	Product name	Field of application
DC47756	Plantainoside D	Plantainoside D shows ACE inhibitory activity with IC50 2.17 mM. And plantainoside D is a promising IKK-β inhibitor.
DC46379	Lyciumin A	Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
DC45903	Camellianin B	Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities.
DC45309	(R)-MLN-4760	(R)-MLN-4760, the R-enantiomer of MLN-4760, is a potent and selective ACE2 inhibitor, with an IC50 of 0.44 nM for human ACE2. (R)-MLN-4760 shows more than 5000-fold selectivity for ACE2 over ACE (IC50>100 μM) and CPDA (IC50=27 μM).
DC44802	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
DC42520	Spirapril hydrochloride	Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active prodrug of Spiraprilat and can be used for the research of hypertension, congestive heart failure.
DC42333	Vicenin-1	Vicenin 1 is a C-glycosylflavone isolated from the aerial parts of Desmodium styracifolium, has any effect on angiotensin-converting enzyme (ACE)(IC50=52.50 μM).
DC41405	Icariside D2	Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
DC40211	H-Ile-Pro-Pro-OH hydrochloride	H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.
DC40003	BML-111	BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties.