β-Amyloid (1-40) (TFA)

  Cat. No.:  DC41528  
Chemical Structure
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
β-Amyloid (1-40) TFA is a primary protein in plaques found in the brains of patients with Alzheimer's disease.
Cas No.:
Chemical Name: β-Amyloid (1-40) (TFA)
Synonyms: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Formula: C194H295N53O58S.C2Hf3O2
M.Wt: 4443.84
Sotrage: Please store the product under the recommended conditions in the Certificate of Analysis.
MSDS
COA
LOT NO. DOWNLOAD
2018-0101
Cat. No. Product name Field of application
DC47758 Aβ Fibrillization modulator 1 Aβ Fibrillization modulator 1 stabilizes Aβ monomers.
DC46940 AZD4694 AZD4694, a fluorinated β-amyloid (Aβ) plaque neuroimaging PET radioligand, shows high affinity for Aβ fibrils (Kd = 2.3 nM).
DC46641 Methyl tridecanoate Methyl tridecanoate moderately inhibits β-amyloid aggregation. Methyl tridecanoate weakly inhibits acetylcholinesterase (AChE).
DC45833 Aβ/tau aggregation-IN-1 Aβ/tau aggregation-IN-1 is a potent Aβ1-42 β-sheets formation and tau aggregation inhibitor. The KD values of Aβ/tau aggregation-IN-1 with Aβ1-42 and tau are 160 μM and 337 μM, respectively. Aβ/tau aggregation-IN-1 can permeate the blood-brain barrier.
DC45771 RAGE antagonist peptide TFA RAGE antagonist peptide TFA is an advanced glycation end products (RAGE) antagonist. RAGE antagonist peptide TFA prevents RAGE from binding with several of its most important ligands, including HMGB-1, S100P, and S100A4. RAGE antagonist peptide TFA possesses anti-tumor and anti-inflammatory activities.
DC44797 Cl-NQTrp Cl-NQTrp signifcantly disrupts the preformed fbrillar aggregates of Tau-derived PHF6 (VQIVYK) peptide and full-length tau protein.
DC44796 Beta-Amyloid(1-14),mouse,rat Beta-Amyloid(1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide.
DC44795 β-Amyloid (22-40) β-Amyloid (22-40) is a peptide fragment of β-Amyloid.
DC44794 β-Amyloid (11-22) β-Amyloid (11-22) is a peptide fragment of β-Amyloid.
DC42447 gamma-Secretase Modulators gamma-Secretase Modulators (Amyloid-β production) is a Amyloid-β production.
X