Kisspeptin-54(human) TFA|CAS 0|DC Chemicals

Cas No.:
Chemical Name:	Kisspeptin-54(human) TFA
Synonyms:	GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
Formula:	C₂₅₈H₄₀₁N₇₉O₇₈^.C₂Hf₃O₂
M.Wt:	5971.45
Sotrage:	Please store the product under the recommended conditions in the Certificate of Analysis.

MSDS

COA

Cat. No.	Product name	Field of application
DC42308	Lecirelin	Lecirelin is a synthetic GnRH (gonadotropin releasing hormone) analogue which shows a great efficacy in the treatment of bovine ovarian follicular cysts.
DC41536	Kisspeptin-54(human) TFA	Kisspeptin-54(human) TFA (Metastin(human) TFA) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) TFA binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) TFA hinders tumor metastasis and stimulates gonadotropin secretion.
DC41535	Kisspeptin-54(human)	Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) hinders tumor metastasis and stimulates gonadotropin secretion.
DC41492	Cetrorelix diacetate	Cetrorelix diacetate (SB-075 diacetate) is a potent gonadotropin-releasing hormone (GnRH) receptor antagonist with an IC50 of 1.21 nM.