Parathyroid hormone (1-34) (rat)

  Cat. No.:  DC41882  
Chemical Structure
98614-76-7
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist, increasing serum PTH levels and bone mass in rats.
Cas No.: 98614-76-7
Chemical Name: Parathyroid hormone (1-34) (rat)
Synonyms: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
Formula: C180H291N55O48S2
M.Wt: 4057.71
Sotrage: Powder-80°C2 years-20°C1 yearIn solvent-80°C6 months-20°C1 month
MSDS
COA
LOT NO. DOWNLOAD
2018-0101
Cat. No. Product name Field of application
DC46974 Glutaurine Glutaurine containing glutamine and taurine residues is an orally active hormone of the parathyroid. Glutaurine, as a hormone, is isolated from parathyroid gland oxyphil cells. Glutaurine can be used for the research of antiepileptic and anti-amnesia.
DC46381 SBC-115337 SBC-115337, as a potent benzofuran compound, is a PCSK9 inhibitor with an IC50 value of 0.5 μM.
DC45609 NH-3 NH-3 is an orally active, reversible thyroid hormone receptor (THR) antagonist with an IC50 of 55 nM. NH-3, a derivative of the selective thyromi-metic GC-1, inhibits binding of thyroid hormones to their receptor and that inhibits cofactor recruitment.
DC45355 1α-Hydroxy-3-epi-vitamin D3 1α-Hydroxy-3-epi-vitamin D3, a natural metabolite of 1alpha,25-dihydroxyvitamin D3, is a potent suppressor of parathyroid hormone (PTH) secretion.
DC45280 DPC-AJ1951 DPC-AJ1951, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR) , and characterized its activity in ex vivo and in vivo assays of bone resorption.
DC42012 Parathyroid Hormone (1-34), human, biotinylated Parathyroid Hormone (1-34), human, biotinylated is a probe for the parathyroid hormone receptor, can be used for analyzing the interaction between parathyroid hormone and parathyroid hormone receptors in living cells and for purifying hormone-receptor complexes with affinity columns.
DC41963 (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) is a potent and competitive antagonist of parathyroid hormone (PTH), with a Ki of 69 nM in bovine renal cortical membrane. (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) can be used for growth and development regulation.
DC41882 Parathyroid hormone (1-34) (rat) Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist, increasing serum PTH levels and bone mass in rats.
DC41829 DPC-AJ1951 TFA DPC-AJ1951 TFA, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR) , and characterized its activity in ex vivo and in vivo assays of bone resorption.
DC41693 Parathyroid Hormone (1-34), bovine TFA Parathyroid Hormone (1-34), bovine TFA is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis.
X