Avexitide

  Cat. No.:  DC45527   Featured
Chemical Structure
133514-43-9
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Avexitide (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.
Cas No.: 133514-43-9
Chemical Name: Exendin(9-39) amide
Synonyms: 9-39-Exendin 3(Heloderma horridum) (9CI);Exendin Fragment 9-39;ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exendin 3 (heloderma horridum),1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine;Exendin 9-39;Exendin(9-39)amide;UNII-5313W10MYT;EXENDIN (9-39);9-39-Exendin 3(Heloderma horridum);EXENDIN 3 (9-39);EXENDIN-3 (9-39) AMIDE;EXENDIN [9-39] PEPTIDE;Exendin (9-39) Acetate;Exendin 4 (9-39) amide;Exendin FragMent 9-39Exendin;M.W. 3369.79 C149H234N40O47S;EXENDIN (9-39) AMIDE;Avexitide;Exendin(9-39) amide
SMILES: [DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2]
Formula: C149H234N40O47S
M.Wt: 3369.75705999998
Purity: 98%
Sotrage: 2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO
MSDS
COA
LOT NO. DOWNLOAD
2018-0101
Cat. No. Product name Field of application
DC74600 Lotiglipron Lotiglipron (PF-07081532) is an orally active GLP-1R agonist. It reduces glucose and body weight, and has the potential to be used in Type 2 diabetes mellitus (T2DM) research.
DC70577 LY3502970 (Orforglipron) LY-3502970 (Orforglipron) is a potent, selective, orally active non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor.LY3502970 is a partial agonist, biased toward G protein activation over β-arrestin recruitment at the GLP-1R.
DC47635 GLP-1R modulator L7-028 GLP-1R modulator L7-028 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC50 11.01 ± 2.73 μM).
DC46189 Teduglutide Teduglutide (ALX-0600, Gattex, Revestive, TAK 633) is an analogue of human glucagon-like peptide-2 (GLP-2) and binds to the GLP-2 receptors. Teduglutide prolongs the intestinotrophic properties of GLP-2 in animal models.
DC45570 Tirzepatide (LY3298176) Tirzepatide (LY3298176, GIP/GLP-1 RA, TZP) is a dual GIP/GLP-1 receptor agonist. Tirzepatide differentially induces internalization of the GIP and GLP-1 receptors with EC50 values of 18.2 nM and 18.1 nM, respectively.
DC45527 Avexitide Avexitide (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.
DC10278 LGD-6972 LGD-6972 is a selective and orally active glucagon receptor antagonist. LGD-6972 has the potential for type 2 diabetes research.
X