Avexitide|CAS 133514-43-9|DC Chemicals

Cas No.:	133514-43-9
Chemical Name:	Exendin(9-39) amide
Synonyms:	9-39-Exendin 3(Heloderma horridum) (9CI);Exendin Fragment 9-39;ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exendin 3 (heloderma horridum),1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine;Exendin 9-39;Exendin(9-39)amide;UNII-5313W10MYT;EXENDIN (9-39);9-39-Exendin 3(Heloderma horridum);EXENDIN 3 (9-39);EXENDIN-3 (9-39) AMIDE;EXENDIN [9-39] PEPTIDE;Exendin (9-39) Acetate;Exendin 4 (9-39) amide;Exendin FragMent 9-39Exendin;M.W. 3369.79 C149H234N40O47S;EXENDIN (9-39) AMIDE;Avexitide;Exendin(9-39) amide
SMILES:	[DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2]
Formula:	C₁₄₉H₂₃₄N₄₀O₄₇S
M.Wt:	3369.75705999998
Purity:	98%
Sotrage:	2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO

MSDS

COA

Cat. No.	Product name	Field of application
DC74600	Lotiglipron	Lotiglipron (PF-07081532) is an orally active GLP-1R agonist. It reduces glucose and body weight, and has the potential to be used in Type 2 diabetes mellitus (T2DM) research.
DC70577	LY3502970 (Orforglipron)	LY-3502970 (Orforglipron) is a potent, selective, orally active non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor.LY3502970 is a partial agonist, biased toward G protein activation over β-arrestin recruitment at the GLP-1R.
DC46189	Teduglutide	Teduglutide (ALX-0600, Gattex, Revestive, TAK 633) is an analogue of human glucagon-like peptide-2 (GLP-2) and binds to the GLP-2 receptors. Teduglutide prolongs the intestinotrophic properties of GLP-2 in animal models.
DC45570	Tirzepatide sodium salt (LY3298176)	Tirzepatide (LY3298176, GIP/GLP-1 RA, TZP) is a dual GIP/GLP-1 receptor agonist. Tirzepatide differentially induces internalization of the GIP and GLP-1 receptors with EC50 values of 18.2 nM and 18.1 nM, respectively.
DC45527	Avexitide	Avexitide (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.
DC10278	LGD-6972	LGD-6972 is a selective and orally active glucagon receptor antagonist. LGD-6972 has the potential for type 2 diabetes research.