- Chemicals for Life Science -

DC Chemicals' products qualify for U.S. tariff exemptions. We guarantee no price increases due to customs duties and maintain stable supply, continuing to deliver reliable research solutions to our American clients.

Home > Products > Novel inhibitors

Super-TDU TFA

Cat. No.: DC46525

Chemical Structure

For research use only. We do not sell to patients.

We match the best price and quality on market.
Email:order@dcchemicals.com sales@dcchemicals.com
Tel:+86-021-58447131

Get Quotation Now

We are official vendor of:

More than 5000 active chemicals with high quality for research!

Field of application

Super-TDU TFA is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU TFA suppresses tumor growth in gastric cancer mouse model.

Chemicals Properties Biological activity COA & MSDS Related products Datasheet

Cas No.:
Chemical Name:	Super-TDU TFA
Synonyms:	SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE
Formula:	C₂₃₉H₃₇₁N₆₆O₇₁S
M.Wt:	5393.96
Sotrage:	2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO

MSDS

COA

LOT NO.	DOWNLOAD

2018-0101

Cat. No.	Product name	Field of application
DC46975	VT103	VT103, an analog of VT101, is an orally active and selective TEAD1 protein palmitoylation inhibitor. VT103 inhibits YAP/TAZ-TEAD promoted gene transcription, blocks TEAD auto-palmitoylation, and disrupts interaction between YAP/TAZ and TEAD. VT103 can be used for the research of cancer.
DC46556	Super-TDU (1-31)	Super-TDU (1-31) is a peptide of Super-TDU, which is an inhibitor of YAP-TEADs, shows potent anti-tumor activity.
DC46525	Super-TDU TFA	Super-TDU TFA is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU TFA suppresses tumor growth in gastric cancer mouse model.

Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.