| DC45058 |
Sephadex LH 20 |
Sephadex LH 20 could be used for the isolation of natural compounds and food, such as red wine and pigments. |
|
| DC45059 |
MEISi-2 |
MEISi-2 is a selective inhibitor of MEIS, a key regulator of hematopoietic stem cell (HSC) self-renewal. MEISi-2 is developed for the research of cardiac injuries, hematopoiesis issues, bone marrow transplantations, and cancer. |
|
| DC45060 |
SCH 32615 |
SCH 32615 is an enkephalinase (the enzymes responsible for the degradation of endogenous enkephalins) inhibitor. SCH 32615 can enhance surgery- and pregnancy-induced analgesia in mice. |
|
| DC45061 |
Nur77 modulator 1 |
Nur77 modulator 1 is a good Nur77 binder (KD = 3.58 μM). Nur77 modulator 1 up-regulates Nur77 expression, mediates sub-cellular localization of Nur77, induces Nur77-dependent ER stress and autophagy, and results in cell apoptosis. Anti-hepatoma activity. |
|
| DC45062 |
N-benzoyl-L-aspartic acid |
N-benzoyl-L-aspartic acid, a major metabolite of benzyl glucosinolate, can be used for modification of peptides or proteins. |
|
| DC45063 |
GPR35 agonist 2 |
GPR35 agonist 2 (compound 11) is a potent agonist of GPR35, with EC50s of 26 and 3.2 nM in the β-arrestin and Ca2+ release assay, respectively. |
|
| DC45064 |
Mifamurtide TFA |
Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide TFA has the potential for osteosarcoma research. |
|
| DC45065 |
TP-472N |
TP-472N is a negative control probe for TP-472. TP-472 is a potent and selective BRD7/9 probe. |
|
| DC45066 |
HaXS8 |
HaXS8 is a dimerizer that can promote a covalent and irreversible intracellular dimerization of HaloTag and SNAP-tagged proteins of interest. HaXS8 does not interfere with PI3K/mTOR signaling. |
|
| DC45067 |
HM-JF526 NHS |
HM-JF526 NHS, a fuorogenic spontaneously blinking yellow-emitting dye, is a hydroxymethyl derivative of JF526. HM-JF526 NHS is suitable for super-resolution imaging including dSTORM, STED and single-molecule localization spectroscopy (SMLSM). |
|
| DC45068 |
PBDB-T |
PBDB-T is a wide bandgap polymer donor in Perylene diimide (PDI)-based polymer solar cells (PSCs). |
|
| DC45069 |
DL-Penicillamine |
DL-Penicillamine (DL-beta-Mercaptovaline, 3,3-Dimethyl-DL-cysteine, 3-Sulfanylvaline, Cuprimine, Depen, DL-PenA, DL-P) induces alteration of elastic fibers of periosteum-perichondrium and associates growth inhibition. |
|
| DC45070 |
NLS (PKKKRKV) (hydrochloride) |
NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research. |
|
| DC45071 |
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN |
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2. |
|
| DC45072 |
LL-37 scrambled peptide |
LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies. |
|
| DC45073 |
Abz-FR-K(Dnp)-P-OH |
Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay. |
|
| DC45074 |
AGA-(C8R) HNG17, humanin derivative |
AGA-(C8R) HNG17, Humanin derivative is a potent humanin (HN) derivative. AGA-(C8R) HNG17, Humanin derivative completely suppresses neuronal cell death by Alzheimer's disease-relevant insults. |
|
| DC45075 |
HIF-1 alpha (556-574) |
HIF-1 alpha (556-574) is a short hypoxia-inducible factor-1 (HIF-1) 19 residues fragment. HIF-1 functions as master regulator of response to oxygen homeostasis. |
|
| DC45076 |
JAG-1, scrambled |
JAG-1, scrambled is a scrambled sequence of JAG-1. JAG-1, scrambled with a random sequence of the amino acids that are the same as the active fragment. JAG-1, scrambled usually used as a negative control. |
|
| DC45077 |
NY-BR-1 p904 (A2) |
NY-BR-1 p904 (A2) is an HLA-A2-restricted NY-BR-1 epitope. T-cell clone specific for NY-BR-1 p904 can recognize breast tumor cells expressing NY-BR-1. |
|
| DC45078 |
TLQP-30 |
TLQP-30 is a VGF peptide. |
|
| DC45079 |
Chemerin-9 (149-157) |
Chemerin-9 (149-157), the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR. |
|
| DC45080 |
Suc-Ile-Glu(γ-pip)-Gly-Arg-pNA hydrochloride |
Suc-Ile-Glu(γ-pip)-Gly-Arg-pNA hydrochloride is a factor Xa specific chromogenic substrate. |
|
| DC45081 |
BDC2.5 mimotope 1040-31 |
BDC2.5 mimotope 1040-31, a BDC2.5 TCR reactive peptide, is a strong agonistic peptide for diabetogenic T cell clone BDC2.5, and the 1040-31 peptide is specific for BDC 2.5 TCR Tg+ T cells. |
|
| DC45082 |
TCTDSTNCYKAT |
TCTDSTNCYKAT is an engineered-variant peptide of antifreeze protein (AFP). |
|
| DC45083 |
Bim BH3, Peptide IV |
Bim BH3, Peptide IV is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins. |
|
| DC45084 |
Hsp70-derived octapeptide |
Hsp70-derived octapeptide is a conserved octapeptide of the C-terminal end of Hsp70, which physically interacts with tetratricopeptide repeat (TPR) motifs. |
|
| DC45085 |
TCS 184 |
TCS 184 is a polypeptide fragment. |
|
| DC45086 |
MCA-SEVNLDAEFR-K(Dnp)-RR, amide |
MCA-SEVNLDAEFR-K(Dnp)-RR, amide is a FRET-based substrate. |
|
| DC45087 |
11R-VIVIT
Featured
|
11R-VIVIT is a potent NFAT inhibitor. 11R-VIVIT inhibits LPS or LPS plus IFN-γ-induced IL-12 p40, IL-12 p70, IL-23 and TNF secretion from bone marrow-derived macrophages (BMDMs). 11R-VIVIT also attenuates NO production and Nos2 mRNA expression in LPS-stimulated BMDMs. 11R-VIVIT improves symptoms in a mouse model of colitis. Exhibits immunosuppressive effects; enhances graft survival in mice. |
|
