| DC45043 |
5'-O-DMT-N2-ibu-dG |
5'-O-DMT-N2-ibu-dG (N2-Isobutyryl-5′-O-(4,4′-dimethoxytrityl)-2′-deoxyguanosine) is a deoxynucleoside which can be used in the preparation of oligonucleotides. |
|
| DC45044 |
Calcium lactate |
Calcium lactate is used by the beverage industry as a source of calcium to fortify fruit juice. Calcium lactate facilitates the growth and phytic acid degradation of soybean sprouts. |
|
| DC45045 |
Cyclocreatine |
Cyclocreatine is a Creatine analogue and acts as a potent bioenergetic protective agent by providing high levels of ATP. Cyclocreatine crosses membranes, enters the brain, and can be phosphorylated and dephosphorylated by creatine kinases. |
|
| DC45046 |
DMT-dI |
DMT-dI (5'-O-DMT-dI) is a deoxyuridine which can be used in the preparation of convertible nucleoside derivatives. |
|
| DC45047 |
L-Lactic acid-13C3 |
L-Lactic acid-13C3 is a stable isotope labeled L-Lactic acid analog. L-Lactic acid-13C3 can be used for lactate metabolism research. |
|
| DC45048 |
N-(3-Aminopropyl)cyclohexylamine |
N-(3-Aminopropyl)cyclohexylamine, a cyclohexylamine derivative, acts as a selective and competitive inhibitor of spermidine synthase. N-(3-Aminopropyl)cyclohexylamine can be used for the research of neurological diseases. |
|
| DC45049 |
Bz-rC Phosphoramidite |
Bz-rC Phosphoramidite is a phosphinamide monomer that can be used in the preparation of oligonucleotides. |
|
| DC45050 |
Cimifugin 4'-O-β-D-glucopyranoside |
Cimifugin 4'-O-β-D-glucopyranoside is a derivative of cimifugin. |
|
| DC45051 |
2'-OMe-Ac-C Phosphoramidite |
2'-OMe-Ac-C Phosphoramidite is a modified phosphoramidite and can be used for the oligonucleotide synthesis. |
|
| DC45052 |
DMT-2′Fluoro-dU Phosphoramidite |
DMT-2′Fluoro-dU Phosphoramidite could be used for nucleoside modification. |
|
| DC45053 |
24:0 Lyso PC |
24:0 Lyso PC is a lysophospholipid (LyP). 24:0 Lyso PC could be used for mRNA drug delivery. |
|
| DC45054 |
N-(3-Methoxybenzyl-(9z,12z)-octadecadienamide |
N-(3-Methoxybenzyl-(9z,12z)-octadecadienamide (Macamide impurity 10), the impurity of Macamide isolated from Lepidium meyenii. |
|
| DC45055 |
Poly(2-hydroxyethyl methacrylate) (MW 1000000) |
Poly(2-hydroxyethyl methacrylate) (MW 1000000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc. |
|
| DC45056 |
Poly(2-hydroxyethyl methacrylate) (MW 20000) |
Poly(2-hydroxyethyl methacrylate) (MW 20000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc. |
|
| DC45057 |
JF635, SE |
JF635, SE (JF635, NHS) is a red fluorogenic fluorescent dye containing an NHS ester that can be conjugated with primary amine groups. JF635, SE can be used in confocal fluorescent imaging, super-resolution microscopy, and live cell imaging. |
|
| DC45058 |
Sephadex LH 20 |
Sephadex LH 20 could be used for the isolation of natural compounds and food, such as red wine and pigments. |
|
| DC45059 |
MEISi-2 |
MEISi-2 is a selective inhibitor of MEIS, a key regulator of hematopoietic stem cell (HSC) self-renewal. MEISi-2 is developed for the research of cardiac injuries, hematopoiesis issues, bone marrow transplantations, and cancer. |
|
| DC45060 |
SCH 32615 |
SCH 32615 is an enkephalinase (the enzymes responsible for the degradation of endogenous enkephalins) inhibitor. SCH 32615 can enhance surgery- and pregnancy-induced analgesia in mice. |
|
| DC45061 |
Nur77 modulator 1 |
Nur77 modulator 1 is a good Nur77 binder (KD = 3.58 μM). Nur77 modulator 1 up-regulates Nur77 expression, mediates sub-cellular localization of Nur77, induces Nur77-dependent ER stress and autophagy, and results in cell apoptosis. Anti-hepatoma activity. |
|
| DC45062 |
N-benzoyl-L-aspartic acid |
N-benzoyl-L-aspartic acid, a major metabolite of benzyl glucosinolate, can be used for modification of peptides or proteins. |
|
| DC45063 |
GPR35 agonist 2 |
GPR35 agonist 2 (compound 11) is a potent agonist of GPR35, with EC50s of 26 and 3.2 nM in the β-arrestin and Ca2+ release assay, respectively. |
|
| DC45064 |
Mifamurtide TFA |
Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide TFA has the potential for osteosarcoma research. |
|
| DC45065 |
TP-472N |
TP-472N is a negative control probe for TP-472. TP-472 is a potent and selective BRD7/9 probe. |
|
| DC45066 |
HaXS8 |
HaXS8 is a dimerizer that can promote a covalent and irreversible intracellular dimerization of HaloTag and SNAP-tagged proteins of interest. HaXS8 does not interfere with PI3K/mTOR signaling. |
|
| DC45067 |
HM-JF526 NHS |
HM-JF526 NHS, a fuorogenic spontaneously blinking yellow-emitting dye, is a hydroxymethyl derivative of JF526. HM-JF526 NHS is suitable for super-resolution imaging including dSTORM, STED and single-molecule localization spectroscopy (SMLSM). |
|
| DC45068 |
PBDB-T |
PBDB-T is a wide bandgap polymer donor in Perylene diimide (PDI)-based polymer solar cells (PSCs). |
|
| DC45069 |
DL-Penicillamine |
DL-Penicillamine (DL-beta-Mercaptovaline, 3,3-Dimethyl-DL-cysteine, 3-Sulfanylvaline, Cuprimine, Depen, DL-PenA, DL-P) induces alteration of elastic fibers of periosteum-perichondrium and associates growth inhibition. |
|
| DC45070 |
NLS (PKKKRKV) (hydrochloride) |
NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research. |
|
| DC45071 |
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN |
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2. |
|
| DC45072 |
LL-37 scrambled peptide |
LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies. |
|
