Pramlintide

  Cat. No.:  DC41496  
Chemical Structure
151126-32-8
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Pramlintide is a polypeptide analogue of human amylin. Pramlintide is an antidiabetic, is antineoplastic in colorectal cancer.
Cas No.: 151126-32-8
Chemical Name: Pramlintide
Synonyms: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
Formula: C171H269N51O53S2
M.Wt: 3951.46
Sotrage: Please store the product under the recommended conditions in the Certificate of Analysis.
MSDS
TITLE DOWNLOAD
MSDS_24509_DC41496_151126-32-8
COA
LOT NO. DOWNLOAD
Cat. No. Product name Field of application
DC47537 MEISi-2 Dihydrochloride MEISi-2 Dihydrochloride is a potent MEIS inhibitor (MEISi) that significantly inhibits MEIS-luciferase reporters in vitro.
DC47863 Palmaturbine hydroxide Palmaturbine hydroxide is isolated from T. sinensis.
DC47862 Hyperectumine Hyperectumine exhibits moderate anti-inflammatory activity via suppression of LPS-activated inflammatory mediators in RAW 264.7 macrophage cells.
DC47861 Cholesterol (Water Soluble) Cholesterol Water Soluble can be used for the research of the effects of cholesterol on the potassium currents in inner hair cells (IHCs). Cholesterol is an integral component of the cell membrane and regulates the activity of ion channels in the lipid bilayer.
DC47860 Phytohemagglutinin P Phytohemagglutinin P (PHA-P) is a mitogen known to selectively stimulate cells of hematogenous or lymphoid monocytic origin.
DC47859 Streptokinase Streptokinase is a bacteria-derived protein and a plasminogen activator. Streptokinase is widely used for the research of the blood-clotting disorders. Streptokinase improves reperfusion blood flow after coronary artery occlusion.
DC47858 P8RI P8RI (D-P8RI) is a biomimetic peptide of CD31 and a CD31 agonist. P8RI binds to the juxtamembrane amino acid sequence of the ectodomain of CD31, shows an immunosuppressive effect through restoration of the CD31 inhibitory pathway.
DC47857 3x DYKDDDDK Tag DYKDDDDK peptide (FLAG) is a useful tool for investigating the function and localization of proteins whose antibodies (Abs) are not available. Often it is also used in a 3X FLAG format (3x DYKDDDDK Tag) for purifying difficult proteins that accumulate in low abundance .
DC47856 3x DYKDDDDK Tag TFA DYKDDDDK peptide (FLAG) is a useful tool for investigating the function and localization of proteins whose antibodies (Abs) are not available. Often it is also used in a 3X FLAG format (3x DYKDDDDK Tag TFA) for purifying difficult proteins that accumulate in low abundance .
DC47855 Anti-inflammatory agent 5 Anti-inflammatory agent 5 displays potent inhibition of NO generation in lipopolysaccharide-induced BV-2 microglial cells.
X