Insulin glargine

  Cat. No.:  DC49413  
Chemical Structure
160337-95-1
For research use only. We do not sell to patients.
We match the best price and quality on market.
Email:order@dcchemicals.com  sales@dcchemicals.com
Tel:+86-021-58447131
We are official vendor of:
  • 20
  • 19
  • 18
  • 17
  • 16
  • 15
  • 14
  • 12
  • 11
  • 10
  • 9
  • 8
  • 13
  • 6
  • 5
  • 4
  • 3
  • 2
  • 1
More than 5000 active chemicals with high quality for research!
Field of application
Insulin glargine is a long-acting insulin analog. Insulin glargine can be used for the diabetes mellitus.
Cas No.: 160337-95-1
Chemical Name: Insulin glargine
Synonyms: A-chain: GIVEQCCTSICSLYQLENYCG;B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)
Formula: C267H404N72O78S6
M.Wt: 6062.89
Sotrage: 2 years -20°C Powder, 2 weeks 4°C in DMSO, 6 months -80°C in DMSO
MSDS
COA
LOT NO. DOWNLOAD
2018-0101
Cat. No. Product name Field of application
DC72496 CMX-2043 CMX-2043 is a novel analogue of α-Lipoic Acid. CMX-2043 is effective in antioxidant effect, activation of insulin receptor kinase, soluble tyrosine kinase, and Akt phosphorylation. CMX-2043 shows protection against ischemia-reperfusion injury (IRI) in rat model.
DC71094 NT219 NT219 is a potent and dual inhibitor of insulin receptor substrates 1/2 (IRS1/2) and STAT3. IRS1/2 and STAT3 are major signaling junctions regulated by various oncogenes. NT219 affects IRS1/2 degradation and inhibits STAT3 phosphorylation. NT219 has the potential for the research of cancer diseases.
DC71030 Demethylasterriquinone B1 Demethylasterriquinone B1 is a selective insulin receptor activator. Demethylasterriquinone B1 stimulates tyrosine phosphorylation of the IR β subunit, and the activation of PIK3 and AKT.
DC50119 AVJ16 AVJ16 is a member of the insulin-like growth factor 2 mRNA-binding protein family. AVJ16 regulates protein translation by binding to the mRNAs of certain genes.
DC50118 HNMPA-(AM)3 HNMPA-(AM)3 is a cell-permeable and selective insulin receptor tyrosine kinase inhibitor analog of HNMPA. HNMPA-(AM)3 greatly inhibits the ability of prothoracicotropic hormone (PTTH) to activate ERK phosphorylation and stimulate ecdysteroidogenesis.
DC49413 Insulin glargine Insulin glargine is a long-acting insulin analog. Insulin glargine can be used for the diabetes mellitus.
DC48362 OI338 OI338 is an orally available, ultralong-acting insulin analogue.
DC47979 HNMPA HNMPA is a membrane impermeable insulin receptor tyrosine kinase inhibitor. HNMPA inhibits serine and tyrosine autophosphorylation by the human insulin receptor. HNMPA has no effect on protein kinase C or cyclic AMP-dependent protein kinase activities
X