Poly(2-hydroxyethyl methacrylate) (MW 1000000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.

Poly(2-hydroxyethyl methacrylate) (MW 20000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.

JF635, SE (JF635, NHS) is a red fluorogenic fluorescent dye containing an NHS ester that can be conjugated with primary amine groups. JF635, SE can be used in confocal fluorescent imaging, super-resolution microscopy, and live cell imaging.

Sephadex LH 20 could be used for the isolation of natural compounds and food, such as red wine and pigments.

MEISi-2 is a selective inhibitor of MEIS, a key regulator of hematopoietic stem cell (HSC) self-renewal. MEISi-2 is developed for the research of cardiac injuries, hematopoiesis issues, bone marrow transplantations, and cancer.

SCH 32615 is an enkephalinase (the enzymes responsible for the degradation of endogenous enkephalins) inhibitor. SCH 32615 can enhance surgery- and pregnancy-induced analgesia in mice.

Nur77 modulator 1 is a good Nur77 binder (KD = 3.58 μM). Nur77 modulator 1 up-regulates Nur77 expression, mediates sub-cellular localization of Nur77, induces Nur77-dependent ER stress and autophagy, and results in cell apoptosis. Anti-hepatoma activity.

N-benzoyl-L-aspartic acid, a major metabolite of benzyl glucosinolate, can be used for modification of peptides or proteins.

GPR35 agonist 2 (compound 11) is a potent agonist of GPR35, with EC50s of 26 and 3.2 nM in the β-arrestin and Ca2+ release assay, respectively.

Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide TFA has the potential for osteosarcoma research.

TP-472N is a negative control probe for TP-472. TP-472 is a potent and selective BRD7/9 probe.

HaXS8 is a dimerizer that can promote a covalent and irreversible intracellular dimerization of HaloTag and SNAP-tagged proteins of interest. HaXS8 does not interfere with PI3K/mTOR signaling.

HM-JF526 NHS, a fuorogenic spontaneously blinking yellow-emitting dye, is a hydroxymethyl derivative of JF526. HM-JF526 NHS is suitable for super-resolution imaging including dSTORM, STED and single-molecule localization spectroscopy (SMLSM).

PBDB-T is a wide bandgap polymer donor in Perylene diimide (PDI)-based polymer solar cells (PSCs).

DL-Penicillamine (DL-beta-Mercaptovaline, 3,3-Dimethyl-DL-cysteine, 3-Sulfanylvaline, Cuprimine, Depen, DL-PenA, DL-P) induces alteration of elastic fibers of periosteum-perichondrium and associates growth inhibition.

NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.

Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay.

AGA-(C8R) HNG17, Humanin derivative is a potent humanin (HN) derivative. AGA-(C8R) HNG17, Humanin derivative completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.

HIF-1 alpha (556-574) is a short hypoxia-inducible factor-1 (HIF-1) 19 residues fragment. HIF-1 functions as master regulator of response to oxygen homeostasis.

JAG-1, scrambled is a scrambled sequence of JAG-1. JAG-1, scrambled with a random sequence of the amino acids that are the same as the active fragment. JAG-1, scrambled usually used as a negative control.

NY-BR-1 p904 (A2) is an HLA-A2-restricted NY-BR-1 epitope. T-cell clone specific for NY-BR-1 p904 can recognize breast tumor cells expressing NY-BR-1.

TLQP-30 is a VGF peptide.

Chemerin-9 (149-157), the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR.

Suc-Ile-Glu(γ-pip)-Gly-Arg-pNA hydrochloride is a factor Xa specific chromogenic substrate.

BDC2.5 mimotope 1040-31, a BDC2.5 TCR reactive peptide, is a strong agonistic peptide for diabetogenic T cell clone BDC2.5, and the 1040-31 peptide is specific for BDC 2.5 TCR Tg+ T cells.

TCTDSTNCYKAT is an engineered-variant peptide of antifreeze protein (AFP).

Bim BH3, Peptide IV is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins.

Hsp70-derived octapeptide is a conserved octapeptide of the C-terminal end of Hsp70, which physically interacts with tetratricopeptide repeat (TPR) motifs.

TCS 184 is a polypeptide fragment.

MCA-SEVNLDAEFR-K(Dnp)-RR, amide is a FRET-based substrate.

11R-VIVIT is a potent NFAT inhibitor. 11R-VIVIT inhibits LPS or LPS plus IFN-γ-induced IL-12 p40, IL-12 p70, IL-23 and TNF secretion from bone marrow-derived macrophages (BMDMs). 11R-VIVIT also attenuates NO production and Nos2 mRNA expression in LPS-stimulated BMDMs. 11R-VIVIT improves symptoms in a mouse model of colitis. Exhibits immunosuppressive effects; enhances graft survival in mice.

Obestatin(human) is an endogenous peptide derived from the same prepropeptide as ghrelin. Obestatin(human) suppresses food intake and reduce body weight-gain in rats.

VPM peptide TFA is a dithiol protease-cleavable peptide cross-linker. VPM peptide TFA can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel.

T7 Tag Peptide TFA is a protein tag derived from the N-terminal 11 residues of the major T7 capsid protein, gp 10. T7 Tag Peptide TFA can be used in different immunoassays as well as affinity purification.

OVA (241-270) TFA, a non-specific cytotoxic T lymphocyte (CTL) peptide, is a fragmented peptide of OVA (ovalbumin) antigen.

TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.

VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel.

Ac2-12, an annexin/lipocortin 1 (LC1)-mimetic peptide, inhibit neutrophil extravasation. Ac2-12 has antimigratory action and inhibits recruitment of neutrophils in experimental inflammation models.

Ac-IEPD-AFC is a substrate of Granzyme B.

9,10-Dihydroxystearic acid is an oxidation product of oleic acid. 9,10-Dihydroxystearic acid can improve glucose tolerance and insulin sensitivity in KKAy mice.

Acenaphthylene is a polycyclic aromatic hydrocarbon (PAH). PAHs are derived naturally from coal and tar deposits, and produced by incomplete combustion of organic matter.

Benzothiazole is a natural occurring heterocyclic nuclei. Benzothiazole nucleus possesses a number of biological activities such as anticancer, antimicrobial, antidiabetic, anti-inflammatory, antiviral, antileishmanial, and antiviral.

Hygric acid (N-Methyl-L-proline) is a proline analogue found in the citrus juices and the juice of bergamot.

p-Fluoro-L-phenylalanine (4-Fluoro-L-phenylalanine) is a substrate for tyrosine hydroxylase (TH) that can be used to study the regulation of that enzyme. p-Fluoro-L-phenylalanine binds to the L-leucine specific receptor of Escherichia coli (KD=0.26 μM).

trans-1,2-Cyclohexanediaminetetraacetic acid is a commonly used aminopolycarboxylic acid and a strong chelator of heavy metal ions.

(-)-Heraclenol is a derivative of furocoumarin isolated from Ducrosia anethifolia. (-)-Heraclenol shows antiproliferative and cytotoxic activities on cancer cell lines.

3-(β-D-Glucopyranosyloxy)-1,6-dihydroxy-2-methyl-9,10-anthracenedione is a anthraquinone isolated from Rubia cordifolia.

5-Hydroxy-8-methoxypsoralen (5-Hydroxyxanthotoxin) is a metabolite of Xanthotoxin. Xanthotoxin is a potent tricyclic furocoumarin suicide inhibitor of CYP (cytochrome P-450), is an agent used to treat psoriasis, eczema, vitiligo and some cutaneous Lymphomas in conjunction with exposing the skin to sunlight.

Cathayanon H is isolated from the paper mulberry tree. Cathayanon H is cytotoxic against human ovariancarcinoma cells.

Diacetoxy-6-gingerdiol is a diarylheptanoid isolated from the dichloromethane extract of rhizomes of ginger (Zingiber officinale Roscoe).

JF549 TFA is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

JF549,SE (JF549,NHS) is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

β-Gentiobiose (Gentiobiose) is a naturally occurring oligosaccharin with a rapid turnover rate in ripening tomato fruit.

(+)-Isolariciresinol ((+)-Cyclolariciresinol) can be used for the research of rheumatitis. Anti-inflammatory activity.

Eicosyl ferulate, a phenolic compound, is isolated from the fresh root and stem of Aristolochia kankauensis. Eicosyl ferulate exhibits glucose uptake stimulatory activity.

DL-Tartaric acid is a non-racemic mixture of L- and D-tartaric acids with antioxidant activities.

Clinopodiside A, a triterpenoid saponin, is isolated from Clinopodium polycephalum which is a popular Chinese traditional medicinal herb.

(-)-Holostyligone is an aryltetralone lignan from Holostylis reniformis Duch.

(+)-N-Formylnorglaucine is an aporphine alkaloid isolated from the leaves of Unonopsis stipitata. (+)-N-Formylnorglaucine contains a formyl group linked to the heterocyclic nitrogen.

1,2,3,4-Tetrahydro-β-carboline-1-carboxylic acid is a chemical used on the study of neurodegenerative diseases.

1,2,3,4-Tetramethylbenzene consists of a benzene ring with four methyl groups (-CH3) as a substituent. 1,2,3,4-Tetramethylbenzene is a specialty product for biochemistry research.

1,2,3-Trimethoxybenzene is a member of the class of compounds known as anisoles. 1,2,3-Trimethoxybenzene can be found in tea, which makes 1,2,3-trimethoxybenzene a potential biomarker for the consumption of this food product.

1,3,5-Triisopropylbenzene acts as a fuel and fuel additive. 1,3,5-Triisopropylbenzene is also used in lubricants and lubricant additives. 1,3,5-Triisopropylbenzene is used as a micelle expander.

1,3-Dihydroxyacetone (DHA), the main active ingredient in sunless tanning skin-care preparations and an important precursor for the synthesis of various fine chemicals, is produced on an industrial scale by microbial fermentation of glycerol over Gluconobacter oxydans.

1,3-Dimethoxybenzene belongs to the class of organic compounds known as dimethoxybenzenes. 1,3-Dimethoxybenzene is an intermediate in synthesis of organic compounds.

1,3-Dimethylpyrazole is a bioactive compound isolated from Moso Bamboo Root.

1,3-Propanediol is produced in nature by the fermentation of glycerol in microorganism.

1-Eicosanol is a natural compound with antioxidant activity isolated from Hypericum carinatum.

1-Pentadecanol is a naturally occurring antiacne agent.

2,2,6-Trimethylcyclohexanone, an intermediate, can be used in the synthesis of β-ionone.

2,3-Dimethyl-2,3-diphenylbutane is one of the decomposition of Dicumylperoxide (DCP). Diallyl orthophthalate (DAOP) is a reactive plasticizer initiated by 2,3-dimethyl-2,3-diphenylbutane for improving polyphenylene oxide (PPO) processing.

2,3-Pentanedione is a common constituent of synthetic flavorings and is used to impart a butter, strawberry, caramel, fruit, rum, or cheese flavor in beverages, ice cream, candy, baked goods, gelatins, and puddings. 2,3-Pentanedione also occurs naturally as a fermentation product in beer, wine, and yogurt and is releasedduring roasting of coffee beans.

2,5-Dimethoxybenzoic acid is an intermediate used in the synthesis of the galbulimima alkaloid GB 13.

2,5-Furandimethanol is obtained from 5-Hydroxymethylfurfural. 5-hydroxymethylfurfural, as a building block, is considered an important intermediate due to its rich chemistry and potential availability from carbohydrates such as fructose, glucose, sucrose, cellulose and inulin.

2,6,6-Trimethylbicyclo[3.1.1]heptan-3-ol is isolated from Chrysanthemum indicum L..

2,6-Dimethylpyrazine is a key aroma compound in Boletus edulis.

2′-O-(2-Methoxyethyl)guanosine (2'-O-MOE-rG), a 2′-O-methoxyethyl-modified nucleoside, can be produced by enzymatic conversion (adenosine deaminase) from 2′-O-(2-methoxyethyl)-2,6-diaminopurine riboside. 2′-O-(2-Methoxyethyl)guanosine neither effectively phosphorylated by cytosolic nucleoside kinases, nor are they incorporated into cellular DNA or RNA.

2'-O-methyluridine is found in rRNA, snRNA, snoRNA and tRNA of Archaea, Bacteria, and Eukaryota.

2-Acetylpyrrole is a product of model browning systems, and has been isolated as a major flavour component of many foods. 2-Acetylpyrrole has been used in the synthesis of 2-acetyl-1-pyrroline.

2-Amino-4-methoxyphenol is a volatile constituent in the aroma concentrate of Tieguanyin teas. 2-Amino-4-methoxyphenol is used for the synthesis of pyridine analogues.

2-Heptanol is one of chemical constituents identified in the essential oil of rhizome of Curcuma angustifolia and Curcuma zedoaria. Rhizome essential oil exhibited good antimicrobial and antioxidant activity.

2-Hydroxymethyl-5-hydroxypyridine is isolated from the the matured, ripened and dried seeds of S. lychnophora.

2-Hydroxymethyltetrahydropyran is a volatile compound in Sambucus williamsii (SW) seed oil. SW seed oil has potential antioxidant activity.

2-Isobutyl-3-methoxypyrazine is an aroma constituent in grapes andwines, green pepper and asparagus.

4-Methylthiophene is an intermediate used in the synthesis of the aromatic sulfur compounds.

2-Propylheptanol is an intermediate and can be used for synthesizing a series of plasticizers by esterification with phthalic anhydride, trimellitic anhydride and adipic acid, etc.

2-Sec-butyl-3-methoxypyrazine (SBMP) is a methoxypyrazine and can be identified in the ladybug species.

3,11,15,23-Tetraoxo-27ξ-lanosta-8,16-dien-26-oic acid, a lanostane-type triterpenoid, is isolated from Antrodia camphorate.

3′,5′-Dimethoxyacetophenone is a natural ketone compound with antioxidant activities. 3′,5′-Dimethoxyacetophenone is a building block in the chemical synthesis.

3-Butenoic acid (Vinylacetic acid) can be used to synthesize bicyclic 3,6-dihydro-1,2-oxazine. Strained bicyclic 3,6-dihydro-1,2-oxazine is a reactive substrate in domino metathesis with an external alkene.

3-Furaldehyde is a member of furans and an aldehyde, and can be used to synthesize the neoclerodane diterpene Salvinorin A.

3-Furanmethanol belongs to the compound class of furan with a wide range of sensory properties. 2-cyanonaphthalenes undergo photocycloaddition reactions with 3-Furanmethanol efficiently and with high degrees of regioselectivity.

3-Methylcarbazole is an carbazole alkaloid compound with anticancer effects. 3-Methylcarbazole shows growth inhibitory activity (IC50 of 25 μg/mL) on human fibrosarcoma HT-1080 cells.

3-Methylcatechol is a building block in the chemical synthesis produced by Pseudomonas putida MC2.

4-Allyltoluene, an aromatic compound, can elicite antennal olfactory response of Mediterranean fruit fly measured by electroantennography (EAG).

4-Aminobenzaldehyde (p-aminobenzaldehyde) is a useful synthetic reagent and monomer that can be used to synthesize monoazo dyes and photocurable ion exchange resins. 4-Aminobenzaldehyde is also a corrosion inhibitor of metals.

4-Ethylresorcinol, a derivative of resorcinol, can act as substrates of tyrosinase. 4-Ethylresorcinol possess hypopigmentary effects. 4-Ethylresorcinol attenuates mRNA and protein expression of tyrosinase-related protein (TRP)-2, and possessed antioxidative effect by inhibiting lipid peroxidation.

4-Hydroxy-4-methylcyclohexanone is a useful synthetic reagent extracted from patent JP2009022162A. 4-Hydroxy-4-methylcyclohexanone can be used to synthesize trans-4-amino-1-methylcyclohexanol which is intermediate of pharmaceutical synthesis.

4-Methyl-1-pentanol (Isohexanol) is a volatile aroma compound of red wine from cv. Kalecik Karasι.

4-Methyl-5,6,7,8-tetrahydroquinoline, a tetrahydroquinoline alkaloid, is isolated from the roots of Glycyrrhiza uralensis Fisch.

5-Hydroxyindole, a hydroxylated indole, can be found in a vast array of pharmacologically active agents and natural products. 5-Hydroxyindole slows desensitization of the 5-HT3 receptor-mediated ion current in N1E-115 neuroblastoma cells.

5-Methyl-2-furanmethanol is a natural product that can be isolated from the essential oil of D. rupicola Biv.. 5-Methyl-2-furanmethanol also acts as a oxidative product of 2,5 dimethylfuran (DMF) by cytochrome P450 (CYP).

Coumalic acid is a valuable platform compound which can be prepared from malic acid. Coumalic acid can be used in the flavours, fragrances and cosmetics industries, as polymer components, and as pharmaceutical scaffolds displaying anti-bronchial and -malarial activity.

Dihydrosinapyl alcohol, a natural product, can be obtained from lignocellulose by hydrogenation and hydrogenolysis.

DL-Pantolactone can be hydrolyzed to Pantoic acid by the lactonohydrolase of Fusarium oxysporum. DL-Pantolactone also can be used in the preparation of 3,5-dinitrobenzoyl-DL-pantolactone.

Ganoderic acid J is a natural terpenoid isolated from the Fungus Ganoderma lucidum. Ganoderic acid J possesses anti-inflammatory anti-inflammatory activity.

Ganoderic acid ε is a natural terpenoid isolated from the Fungus Ganoderma lucidum. Ganoderic acid ε exhibits an ED50 of 12.2 μg/mL in Meth-A tumor cells

Nortrachelogenin ((-)-Wikstromol) from Partrinia scabiosaefolia elicits an apoptotic response in Candida albicans.

Prosaikogenin A is a triterpene saponin isolated from Clinopodium chinense. Prosaikogenin A has significant promoting effects on platelet aggregation with an EC50 value of 12.2 μM.

Prosaikogenin H is an intestinal metabolite of saikosaponin with a weak hemolytic activity.

Triacetonamine (2,2,6,6-Tetramethyl-4-piperidone) monohydrate is used as an intermediate for the synthesis of pharmaceutical products, pesticides and photostabilizers for polymers. Triacetonamine monohydrate is an artifact of plant and fungal extracts using acetone and ammonium hydroxide or natural occurrence of ammonium salts in various steps of the isolation procedures. Triacetonamine monohydrate is the main component of the pyrolysis oil.

Isovitexin 2''-O-arabinoside is an inactive flavonoid in plantlets of Avena sativa L. (Poaceae).

JF646, Tetrazine, a red fluorescent dye, is supplied with a tetrazine reactive handle for copper-free click chemistry. JF646, Tetrazine is suitable for confocal fluorescent imaging, super-resolution microscopy (SRM) techniques such as dSTORM (live and fixed cells) and STED imaging. JF646, Tetrazine is also suitable for flow cytometry.

JF646 TFA, a red fluorogenic fluorescent dye, can be used in the synthesis of Janelia Fluor 646 HaloTag and SNAP-Tag ligands. JF646 TFA is used in live cell imaging experiments and suitable for confocal fluorescent imaging, super resolution microscopy (SRM) techniques such as dSTORM (live and fixed cells) and STED imaging.

JF646, Azide is a red fluorogenic fluorescent dye containing a click chemistry group Azide. JF646, Azide is suitable for confocal fluorescent imaging and super resolution microscopy (SRM) techniques such as dSTORM (live and fixed cells) and STED imaging.

JF526,SE (JF526,NHS) is a fluorogenic yellow fluorescent dye; JF526,SE is supplied as an NHS ester for coupling to primary amine groups. JF526,SE is suitable for confocal fluorescent imaging and super-resolution microscopy (SRM) techniques, such as dSTORM (live and fixed cells) and STED.

Recombinant Proteinase K is a serine protease that cleaves the carboxy-terminated peptide bonds of aliphatic and aromatic amino acids. Recombinant Proteinase K can be used to digest proteins and remove contamination from nucleic acid preparations.

JF549, Azide is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

JF549, Maleimide TFA is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

JF549, Tetrazine is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

2-Aminopurine, a fluorescent analog of guanosine and adenosine, is a widely used fluorescence-decay-based probe of DNA structure. When 2-Aminopurine is inserted in anoligonucleotide, its fluorescence is highly quenched by stacking with the natural bases. 2-Aminopurine has been used to probe nucleic acid structure and dynamics.

2,4,6-Trimethylphenol is a probe compound shown to react mainly with organic matter (3DOM*). 2,4,6-Trimethylphenol is rapidly oxidized by singlet oxygen in aqueous solution.

(+)-Fenchone exists in fennel seed oil (Foenicufum vulgare Mill.) and in the oil of Lavandula stoechas. Fenchone is used as a flavor in foods and in perfumery.

γ-Glutamyl-S-allylcysteine (L-γ-Glutamyl-(S)-Allyl-Cysteine) is a naturally occurring organosulfur compound found in garlic. γ-Glutamyl-S-allylcysteine has antiglycative effect and shows radical-scavenging and metal-chelating capacities.

BODIPY-cholesterol is an intrinsically lipophilic, and cell-permeable analog of cholesterol with a fluorescent BODIPY group. BODIPY-cholesterol can be used to monitor sterol uptake and inter-organelle sterol flux in cells. (Excitation/Emission: 480/508 nm).

JF585, SE (JF585, NHS) is an orange fluorescent dye containing an NHS ester that can be conjugated with primary amine groups. JF585, SE is used in confocal, two-photon excitation and live cell imaging.

JF646, SE (JF646, NHS), a red fluorescent dye, is supplied as an NHS ester for coupling to primary amine groups. JF646, SE is suitable for confocal fluorescent imaging, super resolution microscopy (SRM) techniques such as dSTORM (live and fixed cells) and STED imaging. JF646, SE is also suitable for flow cytometry.

Hydrofurimazine is a NanoLuc substrate whose enhanced aqueous solubility allows delivery of higher doses to mice. Hydrofurimazine enables sensitive bioluminescence imaging for either prolonged light production of high sensitivity.

Vasonatrin Peptide (VNP) TFA is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide TFA possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide TFA protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway.

HA Peptide (TFA) is a nine amino acids peptide derived from the human influenza hemagglutinin (HA). HA Peptide (TFA) is extensively used to isolate, purify, detect, and track the protein of interest in cell biology and biochemistry.

[D-Asn5]-Oxytocin possesses very low specific oxytocic and vasodepressor activities. By cumulative dose-response studies for oxytocic activity, [D-Asn5]-Oxytocin has similar intrinsic activity to oxytocin.

[Glu4]-Oxytocin is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of “oxytocin-like” molecules in aqueous solution.

[Leu3]-Oxytocin, an oxytocin analogue, is derived by structural variation in sequence position 3 replaced by leucine (Leu).

DSTYSLSSTLTLSK is a generic human peptide and can be used for infliximab quantitative detection. Infliximab (Avakine) is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.

Oxytocin free acid (9-Deamidooxytocin) is an analog of oxytocin in which the glycinamide residue at position 9 in oxytocin has been replaced by a glycine residue. Oxytocin is a pleiotropic, peptide hormone with broad implications for general health, adaptation, development, reproduction, and social behavior.

Oxytocin antiparallel dimer is the disulfide-bridged homo peptide dimer.

Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer.

Allo-aca, a leptin peptidomimetic, is a potent, specific leptin receptor antagonist peptide. Allo-aca blocks leptin signaling and action in numerous in vitro and in vivo models.

Manganese(salen) chloride (EUK-8), a superoxide dismutase and catalase mimetic, is an antioxidant with oxyradical scavenging properties. Manganese(salen) chloride ameliorates acute lung injury in endotoxemic swine.

6-Hydroxyrubiadin, a natural anthraquinone, may be a potential therapeutic candidate for the treatment of inflammation and inflammatory diseases.

(Rac)-Salvianic acid A ((Rac)-Danshensu), a phenolic acids, is an efficient radical scavenger and antioxidant.

5-Fluorouridine 5'-O-β-D-galactopyranoside (5'-O-β-D-galactosyl-5-fluorouridine) is a 5-Fluorouridine prodrug. 5-Fluorouridine 5'-O-β-D-galactopyranoside can be converted by the enzyme β-D-galactosidase to the potent antineoplastic agent 5-Fluorouridine.

Damulin A is a saponin found in G. pentaphyllum with anti-cancer activities.

Cucurbitacin A, a triterpenoid that could be isolated from the Stems of Cucumis melo, shows anti-cancer activity.

1αH,5αH-Guaia-6-ene-4β,10β-diol is a sesquiterpenoid derivative identified from Alisma orientale. 1αH,5αH-Guaia-6-ene-4β,10β-diol has anti-cancer activities.

Futoquinol is a neolignan isolated from the dried aerial parts of Piper kadsura (Piperaceae). Futoquinol potently inhibits NO production in microglia cells. Futoquinol has anti-neuroinflammatory activities.

(1S)-Calcitriol (1α,25-Dihydroxy-3-epi-vitamin-D3) is a natural metabolite of 1α,25-dihydroxyvitamin D3 (1α,25(OH)2D3). (1S)-Calcitriol exhibits potent vitamin D receptor (VDR)-mediated actions such as inhibition of keratinocyte growth or suppression of parathyroid hormone secretion.

(R)-(4′-Hydroxy)-5,7-dihydroxy-4-chromanone, a homoisoflavonoid, has antiangiogenic activity against human retinal microvascular endothelial cells.

Fimaporfin (TPCS2a) is an endosomal/lysosomal-localizing photosensitizer.

Decyl maltose neopentyl glycol (DMNG) is the neopentyl glycol detergent that does not disrupt the AlkB oligomeric state. AlkB is a nonheme di-iron alkane hydroxylase.

Cnidicin, a coumarin, inhibits the degranulation of mast cell and the nitric oxide (NO) generation in RAW 264.7 cells.

5-O-Caffeoylshikimic acid can be used in the study for NSCLC.

2-Methyl-1,3,6-trihydroxy-9,10-anthraquinone-3-O-α-rhamnosyl-(1→2)-β-D-glucoside is a natural product that can be isolated from the roots of Rubia cordifolia.

(2S)-7,4'-Dihydroxy-3'-prenylflavan is a natural product.

1,4-Dihydroxy-2-carbomethoxy-3-prenylnaphthalene-1-O-β-D-glucopyranoside is a dihydronaphtoquinone.

ER-Tracker Green is a fluorescent dye that specific for endoplasmic reticulum.

17α-Hydroxyprogesterone acetate possesses progestational activity. 17α-Hydroxyprogesterone acetate has antiinflammatory effects at the murine maternal-fetal interface.

Acetoxyvalerenic acid is a natural compound that could be found in valerian.

Araloside C exhibits protective effects against myocardial ischaemia/reperfusion injury.

5-Benzyloxygramine is a N protein PPI orthosteric stabilizer that exhibits both antiviral and N-NTD protein-stabilizing activities.

Dodecylphosphocholine is a detergent widely utilized in NMR studies of membrane proteins.

Bruceoside A, an abundant quassinoid glycoside in Fructus Bruceae, possesses anti-cancer activity.

Tryptamine guanosine carbamate (TpGc) is a selective HINT1 (histidine triad nucleotide-binding protein 1) inhibitor (Ki=34 μM, Kd=3.65 μM). Tryptamine guanosine carbamate significantly enhances morphine antinociception while preventing the development of tolerance.

2-(2,6-Dioxopiperidin-3-yl)phthalimidine (EM-12), a teratogenic Thalidomide analogue, is more active than Thalidomide and is much more stable for hydrolysis. 2-(2,6-Dioxopiperidin-3-yl)phthalimidine enhances 1,2-dimethylhydrazine-induction of rat colon adenocarcinomas.

Protein deglycase DJ-1 against-1, a DJ-1-binding compound, dependently targets DJ1. Protein deglycase DJ-1 against-1 penetrates through the blood brain barrier (BBB). Protein deglycase DJ-1 against-1 is used as a neuroprotective agent and has the potential for Parkinson's disease research.

CP-346086 dihydrate is a potent and orally active microsomal triglyceride transfer protein (MTP) inhibitor, with an IC50 of 2.0 nM for human and rodent MTP. CP-346086 dihydrate can lower plasma cholesterol and triglycerides in vivo.

Glycerophosphoric acid (disodium salt hydrate) (α and β mixture) is a complex contains α and β Glycerophosphoric acid isomers.

HKSOX-1m (5/6-mixture) hydrobromide is a O2•− fluorescent probe for mitochondria-targeting, exhibiting excellent selectivity and sensitivity toward O2•− over a broad range of pH, strong oxidants, and abundant reductants found in cells.

Cycloartenyl ferulate (Cycloartenol ferulate) is one of the typical triterpene alcohols and possesses several biological activities including anti-oxidative activity, antiallergic activity, anti-inflammatory and anticancer activities.

4',4'''-Di-O-methylisochamaejasminexhibits anti-cancer effect.

Marmesinin ((-)-Marmesinin), a natural coumarin, is a biosynthetic precursor of psoralen and linear furanocoumarins. Marmesinin exhibits significant neuroprotective activities against glutamate-induced toxicity.

NSP-AS is chemiluminescent acridinium substrate II and can be used in homo geneous assays.

Picroside IV is an iridoid glycoside found in the underground parts of Picrorhiza scrophulariiflora. Picroside IV is a derivative of Catalpol. Catalpol has neuroprotective, hypoglycemic, anti-inflammatory, anti-cancer, anti-spasmodic, anti-oxidant effects and anti-HBV effects.

Lappaol A is a natural compound with antiaging activity.

6'-O-β-Apiofuranosylsweroside is a secoiridoid glycoside that can be isolated from the leaves of Lonicera angustifolia Wall.

4-Feruloylquinic acid may be a potential biomarker for food products.

Pseudojervine is a glycoalkaloid with a feeble inhibition activity against platelet aggregation.

Isohemiphloin is a flavonoid compound.

7,2′-Dihydroxy-3′,4′-dimethoxyisoflavan 7-O-β-D-glucoside is a bioactive isoflavonoid isolated from Radix Astragali (Huangqi).

Lupeol palmitate is a natural compound with antiulcer activities. Lupeol palmitate has a gastroprotective action.

Villosolside is an iridoid glucoside that can be isolated from the roots of Patrinia scabra. Villosolside has anti-inflammatory activity.

Genistein 7,4'-di-O-β-D-glucoside is a natural product with significantly estrogenic proliferative effect in MCF-7 cells.

Genistein 7-O-β-D-glucopyranoside-4'-O-[α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside] is an isoflavone triglycoside that could be isolated from Sophora japonica.

Juncusol, a phenanthrenoid found in Juncus setchuenensis, possesses anxiolytic effect. Juncusol is associated with metabolic changes in cortical serotonin/dopamine levels in Mice.

Nortracheloside is a lignan isolated from Trachelospermum jasminoides (Lindl.) Lem.

(R)-Isomucronulatol is a natural flavonoid that could be isolated from the seeds of sphaerophysa salsula.

Eudesmol is a sesquiterpenoid compound produced by Streptomyces tendae.

Lipase Substrate is a substrate of lipase to detect activity.

(+)-Balanophonin is a phenolic compound that could be isolated from Passiflora edulis. (+)-Balanophonin possesses anti-oxidant, anticholinesterase, anti-inflammatory, anticancer, and antineurodegenerative activities.

4β,12-Dihydroxyguaian-6,10-diene, a natural terpene, is isolated from the rhizomes of Alisma orientale.

Protopseudohypericin, a naturally occurring naphthodianthrone, is isolated from H. perforatum. Protopseudohypericin is considered to be the biosynthetic precursor of Pseudohypericin.

17,17-(Ethylenedioxy)androst-4-en-3-one (4-​androstene-​3,​17-​dione-​17-​cyclic ethylene ketal) is an effective ingredient in cosmetics, which can be used for acne and promote hair growth research. 17,17-(Ethylenedioxy)androst-4-en-3-one can inhibit the reductase activity and inhibit the bond of a receptor protein and 5α-DHT.

5-O-Cinnamoylquinic acid is a co-pigment. 5-O-Cinnamoylquinic acid could form the stable blue solution.

12-Deoxywithastramonolide is a principle bioactive compound found in ashwagandha (W. somnifera). 12-Deoxywithastramonolide possesses antioxidant and enzyme inhibitory effects.

3-Feruloylquinic acid, a derivative of quinic acid-bound phenolic acid, shows antioxidant activity. 3-Feruloylquinic acid markedly enhances by high photosynthetically active radiation (PAR) and UV irradiances.

3-Epidehydropachymic acid, a lanostane triterpenoid, shows totoxicity effect against human acute monocytic leukemia cell line THP-1 (IC50=52.51 μM).

L-2-Aminooxy-3-phenylpropanoic acid is a potent inhibitor of L-phenylalanine ammonia-lyase.

3'-O-Methylbatatasin III shows spasmolytic activity.