Home > Inhibitors & Agonists > Others
Cat. No. Product name CAS No.
DC45055 Poly(2-hydroxyethyl methacrylate) (MW 1000000)

Poly(2-hydroxyethyl methacrylate) (MW 1000000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.

25249-16-5
DC45056 Poly(2-hydroxyethyl methacrylate) (MW 20000)

Poly(2-hydroxyethyl methacrylate) (MW 20000) is one of the most important hydrogels in the biomaterials world. Poly(2-hydroxyethyl methacrylate) is the basic component of contact lenses, and is also used in implantation of soft tissues, synthetic transplant for gristle and bone, regeneration of neurotic tissue, transmission of drug and etc.

25249-16-5
DC45057 JF635, SE

JF635, SE (JF635, NHS) is a red fluorogenic fluorescent dye containing an NHS ester that can be conjugated with primary amine groups. JF635, SE can be used in confocal fluorescent imaging, super-resolution microscopy, and live cell imaging.

DC45058 Sephadex LH 20

Sephadex LH 20 could be used for the isolation of natural compounds and food, such as red wine and pigments.

9041-37-6
DC45059 MEISi-2

MEISi-2 is a selective inhibitor of MEIS, a key regulator of hematopoietic stem cell (HSC) self-renewal. MEISi-2 is developed for the research of cardiac injuries, hematopoiesis issues, bone marrow transplantations, and cancer.

2250156-71-7
DC45060 SCH 32615

SCH 32615 is an enkephalinase (the enzymes responsible for the degradation of endogenous enkephalins) inhibitor. SCH 32615 can enhance surgery- and pregnancy-induced analgesia in mice.

83861-02-3
DC45061 Nur77 modulator 1

Nur77 modulator 1 is a good Nur77 binder (KD = 3.58 μM). Nur77 modulator 1 up-regulates Nur77 expression, mediates sub-cellular localization of Nur77, induces Nur77-dependent ER stress and autophagy, and results in cell apoptosis. Anti-hepatoma activity.

2469975-55-9
DC45062 N-benzoyl-L-aspartic acid

N-benzoyl-L-aspartic acid, a major metabolite of benzyl glucosinolate, can be used for modification of peptides or proteins.

4631-12-3
DC45063 GPR35 agonist 2

GPR35 agonist 2 (compound 11) is a potent agonist of GPR35, with EC50s of 26 and 3.2 nM in the β-arrestin and Ca2+ release assay, respectively.

494191-73-0
DC45064 Mifamurtide TFA

Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA, an orphan drug, is a specific ligand of NOD2 used as an insulin sensitizer. Mifamurtide TFA has the potential for osteosarcoma research.

DC45065 TP-472N

TP-472N is a negative control probe for TP-472. TP-472 is a potent and selective BRD7/9 probe.

2080306-24-5
DC45066 HaXS8

HaXS8 is a dimerizer that can promote a covalent and irreversible intracellular dimerization of HaloTag and SNAP-tagged proteins of interest. HaXS8 does not interfere with PI3K/mTOR signaling.

2080306-25-6
DC45067 HM-JF526 NHS

HM-JF526 NHS, a fuorogenic spontaneously blinking yellow-emitting dye, is a hydroxymethyl derivative of JF526. HM-JF526 NHS is suitable for super-resolution imaging including dSTORM, STED and single-molecule localization spectroscopy (SMLSM).

2376841-30-2
DC45068 PBDB-T

PBDB-T is a wide bandgap polymer donor in Perylene diimide (PDI)-based polymer solar cells (PSCs).

1415929-80-4
DC45069 DL-Penicillamine

DL-Penicillamine (DL-beta-Mercaptovaline, 3,3-Dimethyl-DL-cysteine, 3-Sulfanylvaline, Cuprimine, Depen, DL-PenA, DL-P) induces alteration of elastic fibers of periosteum-perichondrium and associates growth inhibition.

52-66-4
DC45070 NLS (PKKKRKV) (hydrochloride)

NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research.

DC45071 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

DC45072 LL-37 scrambled peptide

LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.

DC45073 Abz-FR-K(Dnp)-P-OH

Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay.

500799-61-1
DC45074 AGA-(C8R) HNG17, humanin derivative

AGA-(C8R) HNG17, Humanin derivative is a potent humanin (HN) derivative. AGA-(C8R) HNG17, Humanin derivative completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.

875910-01-3
DC45075 HIF-1 alpha (556-574)

HIF-1 alpha (556-574) is a short hypoxia-inducible factor-1 (HIF-1) 19 residues fragment. HIF-1 functions as master regulator of response to oxygen homeostasis.

1201633-99-9
DC45076 JAG-1, scrambled

JAG-1, scrambled is a scrambled sequence of JAG-1. JAG-1, scrambled with a random sequence of the amino acids that are the same as the active fragment. JAG-1, scrambled usually used as a negative control.

402941-23-5
DC45077 NY-BR-1 p904 (A2)

NY-BR-1 p904 (A2) is an HLA-A2-restricted NY-BR-1 epitope. T-cell clone specific for NY-BR-1 p904 can recognize breast tumor cells expressing NY-BR-1.

347142-73-8
DC45078 TLQP-30

TLQP-30 is a VGF peptide.

922704-13-0
DC45079 Chemerin-9 (149-157)

Chemerin-9 (149-157), the nonapeptide (149)YFPGQFAFS(157) (chemerin-9), corresponding to the C terminus of processed chemerin, retains most of the activity of the full-size protein, with regard to agonism toward the chemerinR.

676367-27-4
DC45080 Suc-Ile-Glu(γ-pip)-Gly-Arg-pNA hydrochloride

Suc-Ile-Glu(γ-pip)-Gly-Arg-pNA hydrochloride is a factor Xa specific chromogenic substrate.

1379822-04-4
DC45081 BDC2.5 mimotope 1040-31

BDC2.5 mimotope 1040-31, a BDC2.5 TCR reactive peptide, is a strong agonistic peptide for diabetogenic T cell clone BDC2.5, and the 1040-31 peptide is specific for BDC 2.5 TCR Tg+ T cells.

329696-49-3
DC45082 TCTDSTNCYKAT

TCTDSTNCYKAT is an engineered-variant peptide of antifreeze protein (AFP).

1621188-94-0
DC45083 Bim BH3, Peptide IV

Bim BH3, Peptide IV is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins.

721885-31-0
DC45084 Hsp70-derived octapeptide

Hsp70-derived octapeptide is a conserved octapeptide of the C-terminal end of Hsp70, which physically interacts with tetratricopeptide repeat (TPR) motifs.

736171-62-3
DC45085 TCS 184

TCS 184 is a polypeptide fragment.

1315378-71-2
DC45086 MCA-SEVNLDAEFR-K(Dnp)-RR, amide

MCA-SEVNLDAEFR-K(Dnp)-RR, amide is a FRET-based substrate.

438625-61-7
DC45087 11R-VIVIT Featured

11R-VIVIT is a potent NFAT inhibitor. 11R-VIVIT inhibits LPS or LPS plus IFN-γ-induced IL-12 p40, IL-12 p70, IL-23 and TNF secretion from bone marrow-derived macrophages (BMDMs). 11R-VIVIT also attenuates NO production and Nos2 mRNA expression in LPS-stimulated BMDMs. 11R-VIVIT improves symptoms in a mouse model of colitis. Exhibits immunosuppressive effects; enhances graft survival in mice.

592517-80-1
DC45088 Obestatin(human)

Obestatin(human) is an endogenous peptide derived from the same prepropeptide as ghrelin. Obestatin(human) suppresses food intake and reduce body weight-gain in rats.

1081110-72-6
DC45089 VPM peptide TFA

VPM peptide TFA is a dithiol protease-cleavable peptide cross-linker. VPM peptide TFA can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel.

DC45090 T7 Tag Peptide TFA

T7 Tag Peptide TFA is a protein tag derived from the N-terminal 11 residues of the major T7 capsid protein, gp 10. T7 Tag Peptide TFA can be used in different immunoassays as well as affinity purification.

DC45091 OVA (241-270) (TFA)

OVA (241-270) TFA, a non-specific cytotoxic T lymphocyte (CTL) peptide, is a fragmented peptide of OVA (ovalbumin) antigen.

DC45092 TAT (48-57)

TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.

253141-50-3
DC45093 VPM peptide

VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel.

1428885-83-9
DC45094 Ac2-12

Ac2-12, an annexin/lipocortin 1 (LC1)-mimetic peptide, inhibit neutrophil extravasation. Ac2-12 has antimigratory action and inhibits recruitment of neutrophils in experimental inflammation models.

256447-08-2
DC45095 Ac-IEPD-AFC

Ac-IEPD-AFC is a substrate of Granzyme B.

1135417-31-0
DC45096 9,10-Dihydroxystearic acid

9,10-Dihydroxystearic acid is an oxidation product of oleic acid. 9,10-Dihydroxystearic acid can improve glucose tolerance and insulin sensitivity in KKAy mice.

120-87-6
DC45097 Acenaphthylene

Acenaphthylene is a polycyclic aromatic hydrocarbon (PAH). PAHs are derived naturally from coal and tar deposits, and produced by incomplete combustion of organic matter.

208-96-8
DC45098 Benzothiazole

Benzothiazole is a natural occurring heterocyclic nuclei. Benzothiazole nucleus possesses a number of biological activities such as anticancer, antimicrobial, antidiabetic, anti-inflammatory, antiviral, antileishmanial, and antiviral.

95-16-9
DC45099 Hygric acid

Hygric acid (N-Methyl-L-proline) is a proline analogue found in the citrus juices and the juice of bergamot.

475-11-6
DC45100 p-Fluoro-L-phenylalanine

p-Fluoro-L-phenylalanine (4-Fluoro-L-phenylalanine) is a substrate for tyrosine hydroxylase (TH) that can be used to study the regulation of that enzyme. p-Fluoro-L-phenylalanine binds to the L-leucine specific receptor of Escherichia coli (KD=0.26 μM).

1132-68-9
DC45101 trans-1,2-Cyclohexanediaminetetraacetic acid

trans-1,2-Cyclohexanediaminetetraacetic acid is a commonly used aminopolycarboxylic acid and a strong chelator of heavy metal ions.

13291-61-7
DC45102 (-)-Heraclenol

(-)-Heraclenol is a derivative of furocoumarin isolated from Ducrosia anethifolia. (-)-Heraclenol shows antiproliferative and cytotoxic activities on cancer cell lines.

139079-42-8
DC45103 3-(β-D-Glucopyranosyloxy)-1,6-dihydroxy-2-methyl-9,10-anthracenedione

3-(β-D-Glucopyranosyloxy)-1,6-dihydroxy-2-methyl-9,10-anthracenedione is a anthraquinone isolated from Rubia cordifolia.

125906-49-2
DC45104 5-Hydroxy-8-methoxypsoralen

5-Hydroxy-8-methoxypsoralen (5-Hydroxyxanthotoxin) is a metabolite of Xanthotoxin. Xanthotoxin is a potent tricyclic furocoumarin suicide inhibitor of CYP (cytochrome P-450), is an agent used to treat psoriasis, eczema, vitiligo and some cutaneous Lymphomas in conjunction with exposing the skin to sunlight.

7471-73-0
DC45105 Cathayanon H

Cathayanon H is isolated from the paper mulberry tree. Cathayanon H is cytotoxic against human ovariancarcinoma cells.

1303438-51-8
DC45106 Diacetoxy-6-gingerdiol

Diacetoxy-6-gingerdiol is a diarylheptanoid isolated from the dichloromethane extract of rhizomes of ginger (Zingiber officinale Roscoe).

143615-75-2
DC45107 JF549 TFA

JF549 TFA is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

2245946-45-4
DC45108 JF549,SE

JF549,SE (JF549,NHS) is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

1811539-32-8
DC45109 β-Gentiobiose

β-Gentiobiose (Gentiobiose) is a naturally occurring oligosaccharin with a rapid turnover rate in ripening tomato fruit.

554-91-6
DC45110 (+)-Isolariciresinol

(+)-Isolariciresinol ((+)-Cyclolariciresinol) can be used for the research of rheumatitis. Anti-inflammatory activity.

548-29-8
DC45111 Eicosyl ferulate

Eicosyl ferulate, a phenolic compound, is isolated from the fresh root and stem of Aristolochia kankauensis. Eicosyl ferulate exhibits glucose uptake stimulatory activity.

133882-79-8
DC45112 DL-Tartaric acid

DL-Tartaric acid is a non-racemic mixture of L- and D-tartaric acids with antioxidant activities.

133-37-9
DC45113 Clinopodiside A

Clinopodiside A, a triterpenoid saponin, is isolated from Clinopodium polycephalum which is a popular Chinese traditional medicinal herb.

142809-89-0
DC45114 (-)-Holostyligone

(-)-Holostyligone is an aryltetralone lignan from Holostylis reniformis Duch.

887501-28-2
DC45115 (+)-N-Formylnorglaucine

(+)-N-Formylnorglaucine is an aporphine alkaloid isolated from the leaves of Unonopsis stipitata. (+)-N-Formylnorglaucine contains a formyl group linked to the heterocyclic nitrogen.

371196-16-6
DC45116 1,2,3,4-Tetrahydro-β-carboline-1-carboxylic acid

1,2,3,4-Tetrahydro-β-carboline-1-carboxylic acid is a chemical used on the study of neurodegenerative diseases.

6649-91-8
DC45117 1,2,3,4-Tetramethylbenzene

1,2,3,4-Tetramethylbenzene consists of a benzene ring with four methyl groups (-CH3) as a substituent. 1,2,3,4-Tetramethylbenzene is a specialty product for biochemistry research.

488-23-3
DC45118 1,2,3-Trimethoxybenzene

1,2,3-Trimethoxybenzene is a member of the class of compounds known as anisoles. 1,2,3-Trimethoxybenzene can be found in tea, which makes 1,2,3-trimethoxybenzene a potential biomarker for the consumption of this food product.

634-36-6
DC45119 1,3,5-Triisopropylbenzene

1,3,5-Triisopropylbenzene acts as a fuel and fuel additive. 1,3,5-Triisopropylbenzene is also used in lubricants and lubricant additives. 1,3,5-Triisopropylbenzene is used as a micelle expander.

717-74-8
DC45120 1,3-Dihydroxyacetone

1,3-Dihydroxyacetone (DHA), the main active ingredient in sunless tanning skin-care preparations and an important precursor for the synthesis of various fine chemicals, is produced on an industrial scale by microbial fermentation of glycerol over Gluconobacter oxydans.

96-26-4
DC45121 1,3-Dimethoxybenzene

1,3-Dimethoxybenzene belongs to the class of organic compounds known as dimethoxybenzenes. 1,3-Dimethoxybenzene is an intermediate in synthesis of organic compounds.

151-10-0
DC45122 1,3-Dimethylpyrazole

1,3-Dimethylpyrazole is a bioactive compound isolated from Moso Bamboo Root.

694-48-4
DC45123 1,3-Propanediol

1,3-Propanediol is produced in nature by the fermentation of glycerol in microorganism.

504-63-2
DC45124 1-Eicosanol

1-Eicosanol is a natural compound with antioxidant activity isolated from Hypericum carinatum.

629-96-9
DC45125 1-Pentadecanol

1-Pentadecanol is a naturally occurring antiacne agent.

629-76-5
DC45126 2,2,6-Trimethylcyclohexanone

2,2,6-Trimethylcyclohexanone, an intermediate, can be used in the synthesis of β-ionone.

2408-37-9
DC45127 2,3-Dimethyl-2,3-diphenylbutane

2,3-Dimethyl-2,3-diphenylbutane is one of the decomposition of Dicumylperoxide (DCP). Diallyl orthophthalate (DAOP) is a reactive plasticizer initiated by 2,3-dimethyl-2,3-diphenylbutane for improving polyphenylene oxide (PPO) processing.

1889-67-4
DC45128 2,3-Pentanedione

2,3-Pentanedione is a common constituent of synthetic flavorings and is used to impart a butter, strawberry, caramel, fruit, rum, or cheese flavor in beverages, ice cream, candy, baked goods, gelatins, and puddings. 2,3-Pentanedione also occurs naturally as a fermentation product in beer, wine, and yogurt and is releasedduring roasting of coffee beans.

600-14-6
DC45129 2,5-Dimethoxybenzoic acid

2,5-Dimethoxybenzoic acid is an intermediate used in the synthesis of the galbulimima alkaloid GB 13.

2785-98-0
DC45130 2,5-Furandimethanol

2,5-Furandimethanol is obtained from 5-Hydroxymethylfurfural. 5-hydroxymethylfurfural, as a building block, is considered an important intermediate due to its rich chemistry and potential availability from carbohydrates such as fructose, glucose, sucrose, cellulose and inulin.

1883-75-6
DC45131 2,6,6-Trimethylbicyclo[3.1.1]heptan-3-ol

2,6,6-Trimethylbicyclo[3.1.1]heptan-3-ol is isolated from Chrysanthemum indicum L..

473-61-0
DC45132 2,6-Dimethylpyrazine

2,6-Dimethylpyrazine is a key aroma compound in Boletus edulis.

108-50-9
DC45133 2′-O-(2-Methoxyethyl)guanosine

2′-O-(2-Methoxyethyl)guanosine (2'-O-MOE-rG), a 2′-O-methoxyethyl-modified nucleoside, can be produced by enzymatic conversion (adenosine deaminase) from 2′-O-(2-methoxyethyl)-2,6-diaminopurine riboside. 2′-O-(2-Methoxyethyl)guanosine neither effectively phosphorylated by cytosolic nucleoside kinases, nor are they incorporated into cellular DNA or RNA.

473278-54-5
DC45134 2′-O-Methyluridine Featured

2'-O-methyluridine is found in rRNA, snRNA, snoRNA and tRNA of Archaea, Bacteria, and Eukaryota.

2140-76-3
DC45135 2-Acetylpyrrole

2-Acetylpyrrole is a product of model browning systems, and has been isolated as a major flavour component of many foods. 2-Acetylpyrrole has been used in the synthesis of 2-acetyl-1-pyrroline.

1072-83-9
DC45136 2-Amino-4-methoxyphenol

2-Amino-4-methoxyphenol is a volatile constituent in the aroma concentrate of Tieguanyin teas. 2-Amino-4-methoxyphenol is used for the synthesis of pyridine analogues.

20734-76-3
DC45137 2-Heptanol

2-Heptanol is one of chemical constituents identified in the essential oil of rhizome of Curcuma angustifolia and Curcuma zedoaria. Rhizome essential oil exhibited good antimicrobial and antioxidant activity.

543-49-7
DC45138 2-Hydroxymethyl-5-hydroxypyridine

2-Hydroxymethyl-5-hydroxypyridine is isolated from the the matured, ripened and dried seeds of S. lychnophora.

40222-77-3
DC45139 2-Hydroxymethyltetrahydropyran

2-Hydroxymethyltetrahydropyran is a volatile compound in Sambucus williamsii (SW) seed oil. SW seed oil has potential antioxidant activity.

100-72-1
DC45140 2-Isobutyl-3-methoxypyrazine

2-Isobutyl-3-methoxypyrazine is an aroma constituent in grapes andwines, green pepper and asparagus.

24683-00-9
DC45141 2-Methylthiophene

4-Methylthiophene is an intermediate used in the synthesis of the aromatic sulfur compounds.

554-14-3
DC45142 2-Propylheptanol

2-Propylheptanol is an intermediate and can be used for synthesizing a series of plasticizers by esterification with phthalic anhydride, trimellitic anhydride and adipic acid, etc.

10042-59-8
DC45143 2-Sec-butyl-3-methoxypyrazine

2-Sec-butyl-3-methoxypyrazine (SBMP) is a methoxypyrazine and can be identified in the ladybug species.

24168-70-5
DC45144 3,11,15,23-Tetraoxo-27ξ-lanosta-8,16-dien-26-oic acid

3,11,15,23-Tetraoxo-27ξ-lanosta-8,16-dien-26-oic acid, a lanostane-type triterpenoid, is isolated from Antrodia camphorate.

1427189-02-3
DC45145 3′,5′-Dimethoxyacetophenone

3′,5′-Dimethoxyacetophenone is a natural ketone compound with antioxidant activities. 3′,5′-Dimethoxyacetophenone is a building block in the chemical synthesis.

39151-19-4
DC45146 3-Butenoic acid

3-Butenoic acid (Vinylacetic acid) can be used to synthesize bicyclic 3,6-dihydro-1,2-oxazine. Strained bicyclic 3,6-dihydro-1,2-oxazine is a reactive substrate in domino metathesis with an external alkene.

625-38-7
DC45147 3-Furaldehyde

3-Furaldehyde is a member of furans and an aldehyde, and can be used to synthesize the neoclerodane diterpene Salvinorin A.

498-60-2
DC45148 3-Furanmethanol

3-Furanmethanol belongs to the compound class of furan with a wide range of sensory properties. 2-cyanonaphthalenes undergo photocycloaddition reactions with 3-Furanmethanol efficiently and with high degrees of regioselectivity.

4412-91-3
DC45149 3-Methylcarbazole

3-Methylcarbazole is an carbazole alkaloid compound with anticancer effects. 3-Methylcarbazole shows growth inhibitory activity (IC50 of 25 μg/mL) on human fibrosarcoma HT-1080 cells.

4630-20-0
DC45150 3-Methylcatechol

3-Methylcatechol is a building block in the chemical synthesis produced by Pseudomonas putida MC2.

488-17-5
DC45151 4-Allyltoluene

4-Allyltoluene, an aromatic compound, can elicite antennal olfactory response of Mediterranean fruit fly measured by electroantennography (EAG).

3333-13-9
DC45152 4-Aminobenzaldehyde

4-Aminobenzaldehyde (p-aminobenzaldehyde) is a useful synthetic reagent and monomer that can be used to synthesize monoazo dyes and photocurable ion exchange resins. 4-Aminobenzaldehyde is also a corrosion inhibitor of metals.

556-18-3
DC45153 4-Ethylresorcinol

4-Ethylresorcinol, a derivative of resorcinol, can act as substrates of tyrosinase. 4-Ethylresorcinol possess hypopigmentary effects. 4-Ethylresorcinol attenuates mRNA and protein expression of tyrosinase-related protein (TRP)-2, and possessed antioxidative effect by inhibiting lipid peroxidation.

2896-60-8
DC45154 4-Hydroxy-4-methylcyclohexanone

4-Hydroxy-4-methylcyclohexanone is a useful synthetic reagent extracted from patent JP2009022162A. 4-Hydroxy-4-methylcyclohexanone can be used to synthesize trans-4-amino-1-methylcyclohexanol which is intermediate of pharmaceutical synthesis.

17429-02-6
DC45155 4-Methyl-1-pentanol

4-Methyl-1-pentanol (Isohexanol) is a volatile aroma compound of red wine from cv. Kalecik Karasι.

626-89-1
DC45156 4-Methyl-5,6,7,8-tetrahydroquinoline

4-Methyl-5,6,7,8-tetrahydroquinoline, a tetrahydroquinoline alkaloid, is isolated from the roots of Glycyrrhiza uralensis Fisch.

28971-03-1
DC45157 5-Hydroxyindole

5-Hydroxyindole, a hydroxylated indole, can be found in a vast array of pharmacologically active agents and natural products. 5-Hydroxyindole slows desensitization of the 5-HT3 receptor-mediated ion current in N1E-115 neuroblastoma cells.

1953-54-4
DC45158 5-Methyl-2-furanmethanol

5-Methyl-2-furanmethanol is a natural product that can be isolated from the essential oil of D. rupicola Biv.. 5-Methyl-2-furanmethanol also acts as a oxidative product of 2,5 dimethylfuran (DMF) by cytochrome P450 (CYP).

3857-25-8
DC45159 Coumalic acid

Coumalic acid is a valuable platform compound which can be prepared from malic acid. Coumalic acid can be used in the flavours, fragrances and cosmetics industries, as polymer components, and as pharmaceutical scaffolds displaying anti-bronchial and -malarial activity.

500-05-0
DC45160 Dihydrosinapyl alcohol

Dihydrosinapyl alcohol, a natural product, can be obtained from lignocellulose by hydrogenation and hydrogenolysis.

20736-25-8
DC45161 DL-Pantolactone

DL-Pantolactone can be hydrolyzed to Pantoic acid by the lactonohydrolase of Fusarium oxysporum. DL-Pantolactone also can be used in the preparation of 3,5-dinitrobenzoyl-DL-pantolactone.

79-50-5
DC45162 Ganoderic acid J

Ganoderic acid J is a natural terpenoid isolated from the Fungus Ganoderma lucidum. Ganoderic acid J possesses anti-inflammatory anti-inflammatory activity.

100440-26-4
DC45163 Ganoderic acid ε

Ganoderic acid ε is a natural terpenoid isolated from the Fungus Ganoderma lucidum. Ganoderic acid ε exhibits an ED50 of 12.2 μg/mL in Meth-A tumor cells

294674-05-8
DC45164 Nortrachelogenin

Nortrachelogenin ((-)-Wikstromol) from Partrinia scabiosaefolia elicits an apoptotic response in Candida albicans.

34444-37-6
DC45165 Prosaikogenin A

Prosaikogenin A is a triterpene saponin isolated from Clinopodium chinense. Prosaikogenin A has significant promoting effects on platelet aggregation with an EC50 value of 12.2 μM.

99365-21-6
DC45166 Prosaikogenin H

Prosaikogenin H is an intestinal metabolite of saikosaponin with a weak hemolytic activity.

99365-22-7
DC45167 Triacetonamine monohydrate

Triacetonamine (2,2,6,6-Tetramethyl-4-piperidone) monohydrate is used as an intermediate for the synthesis of pharmaceutical products, pesticides and photostabilizers for polymers. Triacetonamine monohydrate is an artifact of plant and fungal extracts using acetone and ammonium hydroxide or natural occurrence of ammonium salts in various steps of the isolation procedures. Triacetonamine monohydrate is the main component of the pyrolysis oil.

10581-38-1
DC45168 Isovitexin 2''-O-arabinoside

Isovitexin 2''-O-arabinoside is an inactive flavonoid in plantlets of Avena sativa L. (Poaceae).

53382-71-1
DC45169 JF646, Tetrazine

JF646, Tetrazine, a red fluorescent dye, is supplied with a tetrazine reactive handle for copper-free click chemistry. JF646, Tetrazine is suitable for confocal fluorescent imaging, super-resolution microscopy (SRM) techniques such as dSTORM (live and fixed cells) and STED imaging. JF646, Tetrazine is also suitable for flow cytometry.

2042192-00-5
DC45170 JF646 TFA

JF646 TFA, a red fluorogenic fluorescent dye, can be used in the synthesis of Janelia Fluor 646 HaloTag and SNAP-Tag ligands. JF646 TFA is used in live cell imaging experiments and suitable for confocal fluorescent imaging, super resolution microscopy (SRM) techniques such as dSTORM (live and fixed cells) and STED imaging.

DC45171 JF646, Azide

JF646, Azide is a red fluorogenic fluorescent dye containing a click chemistry group Azide. JF646, Azide is suitable for confocal fluorescent imaging and super resolution microscopy (SRM) techniques such as dSTORM (live and fixed cells) and STED imaging.

DC45172 JF526,SE

JF526,SE (JF526,NHS) is a fluorogenic yellow fluorescent dye; JF526,SE is supplied as an NHS ester for coupling to primary amine groups. JF526,SE is suitable for confocal fluorescent imaging and super-resolution microscopy (SRM) techniques, such as dSTORM (live and fixed cells) and STED.

DC45173 Recombinant Proteinase K

Recombinant Proteinase K is a serine protease that cleaves the carboxy-terminated peptide bonds of aliphatic and aromatic amino acids. Recombinant Proteinase K can be used to digest proteins and remove contamination from nucleic acid preparations.

DC45174 JF549, Azide

JF549, Azide is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

DC45175 JF549, Maleimide TFA

JF549, Maleimide TFA is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

DC45176 JF549, Tetrazine

JF549, Tetrazine is a fluorescent dye with the absorption maximum (λab (max)) of 549 nm and emission maximum (λem (max)) of 571 nm.

DC45177 2-Aminopurine

2-Aminopurine, a fluorescent analog of guanosine and adenosine, is a widely used fluorescence-decay-based probe of DNA structure. When 2-Aminopurine is inserted in anoligonucleotide, its fluorescence is highly quenched by stacking with the natural bases. 2-Aminopurine has been used to probe nucleic acid structure and dynamics.

452-06-2
DC45178 2,4,6-Trimethylphenol

2,4,6-Trimethylphenol is a probe compound shown to react mainly with organic matter (3DOM*). 2,4,6-Trimethylphenol is rapidly oxidized by singlet oxygen in aqueous solution.

527-60-6
DC45179 (+)-Fenchone

(+)-Fenchone exists in fennel seed oil (Foenicufum vulgare Mill.) and in the oil of Lavandula stoechas. Fenchone is used as a flavor in foods and in perfumery.

4695-62-9
DC45180 γ-Glutamyl-S-allylcysteine

γ-Glutamyl-S-allylcysteine (L-γ-Glutamyl-(S)-Allyl-Cysteine) is a naturally occurring organosulfur compound found in garlic. γ-Glutamyl-S-allylcysteine has antiglycative effect and shows radical-scavenging and metal-chelating capacities.

91216-95-4
DC45181 BODIPY-Cholesterol

BODIPY-cholesterol is an intrinsically lipophilic, and cell-permeable analog of cholesterol with a fluorescent BODIPY group. BODIPY-cholesterol can be used to monitor sterol uptake and inter-organelle sterol flux in cells. (Excitation/Emission: 480/508 nm).

878557-19-8
DC45182 JF585, SE

JF585, SE (JF585, NHS) is an orange fluorescent dye containing an NHS ester that can be conjugated with primary amine groups. JF585, SE is used in confocal, two-photon excitation and live cell imaging.

1811539-88-4
DC45183 JF646, SE

JF646, SE (JF646, NHS), a red fluorescent dye, is supplied as an NHS ester for coupling to primary amine groups. JF646, SE is suitable for confocal fluorescent imaging, super resolution microscopy (SRM) techniques such as dSTORM (live and fixed cells) and STED imaging. JF646, SE is also suitable for flow cytometry.

1811539-59-9
DC45184 Hydrofurimazine Featured

Hydrofurimazine is a NanoLuc substrate whose enhanced aqueous solubility allows delivery of higher doses to mice. Hydrofurimazine enables sensitive bioluminescence imaging for either prolonged light production of high sensitivity.

2179052-10-7
DC45296 Vasonatrin Peptide (VNP) (TFA)

Vasonatrin Peptide (VNP) TFA is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide TFA possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide TFA protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway.

DC45297 HA Peptide TFA

HA Peptide (TFA) is a nine amino acids peptide derived from the human influenza hemagglutinin (HA). HA Peptide (TFA) is extensively used to isolate, purify, detect, and track the protein of interest in cell biology and biochemistry.

DC45298 [D-Asn5]-Oxytocin

[D-Asn5]-Oxytocin possesses very low specific oxytocic and vasodepressor activities. By cumulative dose-response studies for oxytocic activity, [D-Asn5]-Oxytocin has similar intrinsic activity to oxytocin.

5754-53-0
DC45299 [Glu4]-Oxytocin

[Glu4]-Oxytocin is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of “oxytocin-like” molecules in aqueous solution.

4314-67-4
DC45300 [Leu3]-Oxytocin

[Leu3]-Oxytocin, an oxytocin analogue, is derived by structural variation in sequence position 3 replaced by leucine (Leu).

4294-11-5
DC45301 DSTYSLSSTLTLSK

DSTYSLSSTLTLSK is a generic human peptide and can be used for infliximab quantitative detection. Infliximab (Avakine) is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.

177792-42-6
DC45302 Oxytocin free acid

Oxytocin free acid (9-Deamidooxytocin) is an analog of oxytocin in which the glycinamide residue at position 9 in oxytocin has been replaced by a glycine residue. Oxytocin is a pleiotropic, peptide hormone with broad implications for general health, adaptation, development, reproduction, and social behavior.

4248-64-0
DC45305 Oxytocin antiparallel dimer

Oxytocin antiparallel dimer is the disulfide-bridged homo peptide dimer.

20054-93-7
DC45306 Oxytocin parallel dimer

Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer.

19645-28-4
DC45307 Allo-aca

Allo-aca, a leptin peptidomimetic, is a potent, specific leptin receptor antagonist peptide. Allo-aca blocks leptin signaling and action in numerous in vitro and in vivo models.

DC45319 Manganese(salen) chloride

Manganese(salen) chloride (EUK-8), a superoxide dismutase and catalase mimetic, is an antioxidant with oxyradical scavenging properties. Manganese(salen) chloride ameliorates acute lung injury in endotoxemic swine.

53177-12-1
DC45327 6-Hydroxyrubiadin

6-Hydroxyrubiadin, a natural anthraquinone, may be a potential therapeutic candidate for the treatment of inflammation and inflammatory diseases.

87686-86-0
DC45328 (Rac)-Salvianic acid A

(Rac)-Salvianic acid A ((Rac)-Danshensu), a phenolic acids, is an efficient radical scavenger and antioxidant.

23028-17-3
DC45329 5-Fluorouridine 5'-O-β-D-galactopyranoside

5-Fluorouridine 5'-O-β-D-galactopyranoside (5'-O-β-D-galactosyl-5-fluorouridine) is a 5-Fluorouridine prodrug. 5-Fluorouridine 5'-O-β-D-galactopyranoside can be converted by the enzyme β-D-galactosidase to the potent antineoplastic agent 5-Fluorouridine.

149965-92-4
DC45339 Damulin A

Damulin A is a saponin found in G. pentaphyllum with anti-cancer activities.

1202868-74-3
DC45340 Cucurbitacin A

Cucurbitacin A, a triterpenoid that could be isolated from the Stems of Cucumis melo, shows anti-cancer activity.

6040-19-3
DC45343 1αH,5αH-Guaia-6-ene-4β,10β-diol

1αH,5αH-Guaia-6-ene-4β,10β-diol is a sesquiterpenoid derivative identified from Alisma orientale. 1αH,5αH-Guaia-6-ene-4β,10β-diol has anti-cancer activities.

2013537-81-8
DC45345 Futoquinol

Futoquinol is a neolignan isolated from the dried aerial parts of Piper kadsura (Piperaceae). Futoquinol potently inhibits NO production in microglia cells. Futoquinol has anti-neuroinflammatory activities.

28178-92-9
DC45346 (1S)-Calcitriol

(1S)-Calcitriol (1α,25-Dihydroxy-3-epi-vitamin-D3) is a natural metabolite of 1α,25-dihydroxyvitamin D3 (1α,25(OH)2D3). (1S)-Calcitriol exhibits potent vitamin D receptor (VDR)-mediated actions such as inhibition of keratinocyte growth or suppression of parathyroid hormone secretion.

61476-45-7
DC45347 (R)-(4′-Hydroxy)-5,7-dihydroxy-4-chromanone

(R)-(4′-Hydroxy)-5,7-dihydroxy-4-chromanone, a homoisoflavonoid, has antiangiogenic activity against human retinal microvascular endothelial cells.

849727-88-4
DC45349 Fimaporfin

Fimaporfin (TPCS2a) is an endosomal/lysosomal-localizing photosensitizer.

1443547-43-0
DC45350 Decyl maltose neopentyl glycol

Decyl maltose neopentyl glycol (DMNG) is the neopentyl glycol detergent that does not disrupt the AlkB oligomeric state. AlkB is a nonheme di-iron alkane hydroxylase.

1257852-99-5
DC45351 Cnidicin

Cnidicin, a coumarin, inhibits the degranulation of mast cell and the nitric oxide (NO) generation in RAW 264.7 cells.

14348-21-1
DC45353 5-O-Caffeoylshikimic acid

5-O-Caffeoylshikimic acid can be used in the study for NSCLC.

73263-62-4
DC45354 2-Methyl-1,3,6-trihydroxy-9,10-anthraquinone-3-O-α-rhamnosyl-(1→2)-β-D-glucoside

2-Methyl-1,3,6-trihydroxy-9,10-anthraquinone-3-O-α-rhamnosyl-(1→2)-β-D-glucoside is a natural product that can be isolated from the roots of Rubia cordifolia.

87686-87-1
DC45356 (2S)-7,4'-Dihydroxy-3'-prenylflavan

(2S)-7,4'-Dihydroxy-3'-prenylflavan is a natural product.

376361-96-5
DC45357 1,4-Dihydroxy-2-carbomethoxy-3-prenylnaphthalene-1-O-β-D-glucopyranoside

1,4-Dihydroxy-2-carbomethoxy-3-prenylnaphthalene-1-O-β-D-glucopyranoside is a dihydronaphtoquinone.

1415729-43-9
DC45358 ER-Tracker Green

ER-Tracker Green is a fluorescent dye that specific for endoplasmic reticulum.

730931-46-1
DC45360 17α-Hydroxyprogesterone acetate

17α-Hydroxyprogesterone acetate possesses progestational activity. 17α-Hydroxyprogesterone acetate has antiinflammatory effects at the murine maternal-fetal interface.

302-23-8
DC45362 Acetoxyvalerenic acid

Acetoxyvalerenic acid is a natural compound that could be found in valerian.

84638-55-1
DC45364 Araloside C

Araloside C exhibits protective effects against myocardial ischaemia/reperfusion injury.

55446-15-6
DC45371 5-Benzyloxygramine

5-Benzyloxygramine is a N protein PPI orthosteric stabilizer that exhibits both antiviral and N-NTD protein-stabilizing activities.

1453-97-0
DC45372 Dodecylphosphocholine Featured

Dodecylphosphocholine is a detergent widely utilized in NMR studies of membrane proteins.

29557-51-5
DC45374 Bruceoside A

Bruceoside A, an abundant quassinoid glycoside in Fructus Bruceae, possesses anti-cancer activity.

63306-30-9
DC45375 Tryptamine guanosine carbamate

Tryptamine guanosine carbamate (TpGc) is a selective HINT1 (histidine triad nucleotide-binding protein 1) inhibitor (Ki=34 μM, Kd=3.65 μM). Tryptamine guanosine carbamate significantly enhances morphine antinociception while preventing the development of tolerance.

1414808-96-0
DC60410 CID91585 Featured

2-(2,6-Dioxopiperidin-3-yl)phthalimidine (EM-12), a teratogenic Thalidomide analogue, is more active than Thalidomide and is much more stable for hydrolysis. 2-(2,6-Dioxopiperidin-3-yl)phthalimidine enhances 1,2-dimethylhydrazine-induction of rat colon adenocarcinomas.

26581-81-7
DC45380 Protein deglycase DJ-1 against-1

Protein deglycase DJ-1 against-1, a DJ-1-binding compound, dependently targets DJ1. Protein deglycase DJ-1 against-1 penetrates through the blood brain barrier (BBB). Protein deglycase DJ-1 against-1 is used as a neuroprotective agent and has the potential for Parkinson's disease research.

724737-74-0
DC45385 CP-346086 dihydrate

CP-346086 dihydrate is a potent and orally active microsomal triglyceride transfer protein (MTP) inhibitor, with an IC50 of 2.0 nM for human and rodent MTP. CP-346086 dihydrate can lower plasma cholesterol and triglycerides in vivo.

1262769-98-1
DC45389 Glycerophosphoric acid disodium salt hydrate (α and β mixture)

Glycerophosphoric acid (disodium salt hydrate) (α and β mixture) is a complex contains α and β Glycerophosphoric acid isomers.

DC45391 HKSOX-1m (5/6-mixture) (hydrobromide)

HKSOX-1m (5/6-mixture) hydrobromide is a O2•− fluorescent probe for mitochondria-targeting, exhibiting excellent selectivity and sensitivity toward O2•− over a broad range of pH, strong oxidants, and abundant reductants found in cells.

DC45392 Cycloartenyl ferulate

Cycloartenyl ferulate (Cycloartenol ferulate) is one of the typical triterpene alcohols and possesses several biological activities including anti-oxidative activity, antiallergic activity, anti-inflammatory and anticancer activities.

21238-33-5
DC45393 4',4'''-Di-O-methylisochamaejasmin

4',4'''-Di-O-methylisochamaejasminexhibits anti-cancer effect.

1620921-68-7
DC45394 Marmesinin

Marmesinin ((-)-Marmesinin), a natural coumarin, is a biosynthetic precursor of psoralen and linear furanocoumarins. Marmesinin exhibits significant neuroprotective activities against glutamate-induced toxicity.

495-30-7
DC45395 NSP-AS

NSP-AS is chemiluminescent acridinium substrate II and can be used in homo geneous assays.

211106-69-3
DC45396 Picroside IV

Picroside IV is an iridoid glycoside found in the underground parts of Picrorhiza scrophulariiflora. Picroside IV is a derivative of Catalpol. Catalpol has neuroprotective, hypoglycemic, anti-inflammatory, anti-cancer, anti-spasmodic, anti-oxidant effects and anti-HBV effects.

211567-04-3
DC45398 Lappaol A

Lappaol A is a natural compound with antiaging activity.

62333-08-8
DC45399 6'-O-β-Apiofuranosylsweroside

6'-O-β-Apiofuranosylsweroside is a secoiridoid glycoside that can be isolated from the leaves of Lonicera angustifolia Wall.

266678-59-5
DC45401 4-Feruloylquinic acid

4-Feruloylquinic acid may be a potential biomarker for food products.

2613-86-7
DC45402 Pseudojervine

Pseudojervine is a glycoalkaloid with a feeble inhibition activity against platelet aggregation.

36069-05-3
DC45403 Isohemiphloin

Isohemiphloin is a flavonoid compound.

3682-02-8
DC45407 7,2′-Dihydroxy-3′,4′-dimethoxyisoflavan 7-O-β-D-glucoside

7,2′-Dihydroxy-3′,4′-dimethoxyisoflavan 7-O-β-D-glucoside is a bioactive isoflavonoid isolated from Radix Astragali (Huangqi).

94367-43-8
DC45409 Lupeol palmitate

Lupeol palmitate is a natural compound with antiulcer activities. Lupeol palmitate has a gastroprotective action.

32214-80-5
DC45410 Villosolside

Villosolside is an iridoid glucoside that can be isolated from the roots of Patrinia scabra. Villosolside has anti-inflammatory activity.

99933-30-9
DC45411 Genistein 7,4'-di-O-β-D-glucoside

Genistein 7,4'-di-O-β-D-glucoside is a natural product with significantly estrogenic proliferative effect in MCF-7 cells.

36190-98-4
DC45413 Genistein 7-O-β-D-glucopyranoside-4'-O-[α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside]

Genistein 7-O-β-D-glucopyranoside-4'-O-[α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside] is an isoflavone triglycoside that could be isolated from Sophora japonica.

70404-42-1
DC45414 Juncusol

Juncusol, a phenanthrenoid found in Juncus setchuenensis, possesses anxiolytic effect. Juncusol is associated with metabolic changes in cortical serotonin/dopamine levels in Mice.

62023-90-9
DC45415 Nortracheloside

Nortracheloside is a lignan isolated from Trachelospermum jasminoides (Lindl.) Lem.

33464-78-7
DC45416 (R)-Isomucronulatol

(R)-Isomucronulatol is a natural flavonoid that could be isolated from the seeds of sphaerophysa salsula.

64474-51-7
DC45417 Eudesmol

Eudesmol is a sesquiterpenoid compound produced by Streptomyces tendae.

51317-08-9
DC45418 Lipase Substrate Featured

Lipase Substrate is a substrate of lipase to detect activity.

195833-46-6
DC45419 (+)-Balanophonin

(+)-Balanophonin is a phenolic compound that could be isolated from Passiflora edulis. (+)-Balanophonin possesses anti-oxidant, anticholinesterase, anti-inflammatory, anticancer, and antineurodegenerative activities.

215319-47-4
DC45420 4β,12-Dihydroxyguaian-6,10-diene

4β,12-Dihydroxyguaian-6,10-diene, a natural terpene, is isolated from the rhizomes of Alisma orientale.

461644-90-6
DC45421 Protopseudohypericin

Protopseudohypericin, a naturally occurring naphthodianthrone, is isolated from H. perforatum. Protopseudohypericin is considered to be the biosynthetic precursor of Pseudohypericin.

54328-09-5
DC45424 17,17-(Ethylenedioxy)androst-4-en-3-one

17,17-(Ethylenedioxy)androst-4-en-3-one (4-​androstene-​3,​17-​dione-​17-​cyclic ethylene ketal) is an effective ingredient in cosmetics, which can be used for acne and promote hair growth research. 17,17-(Ethylenedioxy)androst-4-en-3-one can inhibit the reductase activity and inhibit the bond of a receptor protein and 5α-DHT.

1044-89-9
DC45425 5-O-Cinnamoylquinic acid

5-O-Cinnamoylquinic acid is a co-pigment. 5-O-Cinnamoylquinic acid could form the stable blue solution.

5515-82-2
DC45426 12-Deoxywithastramonolide

12-Deoxywithastramonolide is a principle bioactive compound found in ashwagandha (W. somnifera). 12-Deoxywithastramonolide possesses antioxidant and enzyme inhibitory effects.

60124-17-6
DC45427 3-Feruloylquinic acid

3-Feruloylquinic acid, a derivative of quinic acid-bound phenolic acid, shows antioxidant activity. 3-Feruloylquinic acid markedly enhances by high photosynthetically active radiation (PAR) and UV irradiances.

1899-29-2
DC45428 3-Epidehydropachymic acid

3-Epidehydropachymic acid, a lanostane triterpenoid, shows totoxicity effect against human acute monocytic leukemia cell line THP-1 (IC50=52.51 μM).

168293-15-0
DC45430 L-2-Aminooxy-3-phenylpropanoic acid

L-2-Aminooxy-3-phenylpropanoic acid is a potent inhibitor of L-phenylalanine ammonia-lyase.

42990-62-5
DC45432 3'-O-Methylbatatasin III

3'-O-Methylbatatasin III shows spasmolytic activity.

101330-69-2
<Prev1...8384858687...127Next>